KEGG   Amphibacillus xylanus: AXY_14160Help
Entry
AXY_14160         CDS       T02266                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
axl  Amphibacillus xylanus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AXY_14160 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_14160 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AXY_14160 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AXY_14160 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXY_14160 (adh)
   00626 Naphthalene degradation
    AXY_14160 (adh)
Enzymes [BR:axl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXY_14160 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1455173..1456192)
Genome map
AA seq 339 aa AA seqDB search
MRAVVVSDSKDKLVEVKEVELRPIQKGEALVDIEYCGVCHTDLHVAKGDFGAVPGRIPGH
EGVGIVREVADDVTSLKVGDRVSIAWFFEGCGRCEYCLTGRETYCRQAKNAGYSVDGAMA
EQCIVSADYAVKVPEGLDARQATSITCAGVTTYKAIKEAKIEPGEWIVIYGAGGLGNLAI
QYAKKVFNFKVIAVDINDDKLALAKETGADLIFNSTDQDPAEWIQKEVGGAHAAVVTAVS
KVAFKQAVDSVRPTARVVNVGLPPETMDLDIIKSVLDGIQVVGSLVGTRKDLEEAFMFGA
EGKVVPVVQTRRLDEINEIFEEMEKGTINGRMVLDMSLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtcgttgtttcagattcaaaagacaaattagtagaggtaaaagaagttgaa
ttaagaccaatccagaagggggaagcattggttgacattgaatactgcggggtctgtcat
actgacctacacgtggctaaaggggattttggagctgttccaggaagaattccaggtcat
gaaggagtaggtattgtaagagaagtagcagatgacgttactagtttgaaagtaggggat
cgtgttagtatcgcttggttctttgaagggtgtggtcgttgtgaatattgcttaactggc
cgtgaaacatattgtcgacaagcaaaaaatgctggatactctgttgatggagcgatggca
gaacaatgtatcgttagtgcagattatgcagtaaaagttcctgaaggattagatgcaaga
caagcaacaagtattacttgtgccggagtaacaacatacaaagcaattaaagaagcaaaa
atagagccaggcgaatggattgttatttacggtgccggaggacttggtaacctagcaatt
caatatgctaaaaaagtatttaattttaaagttattgcagttgatataaatgatgataaa
ttagcattagcaaaagagacaggtgcagatttaatctttaattcaacagatcaagatcca
gcagaatggattcaaaaagaagtaggtggcgcacatgccgcagttgtaacagctgtttca
aaagttgcatttaaacaagctgttgattcagtacgtcctactgctagagtagtaaacgtt
ggtctaccacctgaaacaatggatttagatataattaaatcagtactagacggcattcaa
gtagttggttcattagttggaacgcgtaaagatcttgaagaagcatttatgtttggcgca
gaaggtaaggttgtcccagttgtccaaacgcgtcgattagatgaaatcaatgaaatattc
gaagaaatggaaaaaggaactattaatggccgtatggttcttgacatgtcactaaaataa

DBGET integrated database retrieval system