KEGG   Amphibacillus xylanus: AXY_14160Help
Entry
AXY_14160         CDS       T02266                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
axl  Amphibacillus xylanus
Pathway
axl00010  Glycolysis / Gluconeogenesis
axl00071  Fatty acid degradation
axl00350  Tyrosine metabolism
axl00625  Chloroalkane and chloroalkene degradation
axl00626  Naphthalene degradation
axl01100  Metabolic pathways
axl01110  Biosynthesis of secondary metabolites
axl01120  Microbial metabolism in diverse environments
axl01130  Biosynthesis of antibiotics
axl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_14160 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AXY_14160 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AXY_14160 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXY_14160 (adh)
   00626 Naphthalene degradation
    AXY_14160 (adh)
Enzymes [BR:axl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXY_14160 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Sacchrp_dh_NADP TrkA_N Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: BAM47548
UniProt: K0J7K9
Position
complement(1455173..1456192)
Genome map
AA seq 339 aa AA seqDB search
MRAVVVSDSKDKLVEVKEVELRPIQKGEALVDIEYCGVCHTDLHVAKGDFGAVPGRIPGH
EGVGIVREVADDVTSLKVGDRVSIAWFFEGCGRCEYCLTGRETYCRQAKNAGYSVDGAMA
EQCIVSADYAVKVPEGLDARQATSITCAGVTTYKAIKEAKIEPGEWIVIYGAGGLGNLAI
QYAKKVFNFKVIAVDINDDKLALAKETGADLIFNSTDQDPAEWIQKEVGGAHAAVVTAVS
KVAFKQAVDSVRPTARVVNVGLPPETMDLDIIKSVLDGIQVVGSLVGTRKDLEEAFMFGA
EGKVVPVVQTRRLDEINEIFEEMEKGTINGRMVLDMSLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtcgttgtttcagattcaaaagacaaattagtagaggtaaaagaagttgaa
ttaagaccaatccagaagggggaagcattggttgacattgaatactgcggggtctgtcat
actgacctacacgtggctaaaggggattttggagctgttccaggaagaattccaggtcat
gaaggagtaggtattgtaagagaagtagcagatgacgttactagtttgaaagtaggggat
cgtgttagtatcgcttggttctttgaagggtgtggtcgttgtgaatattgcttaactggc
cgtgaaacatattgtcgacaagcaaaaaatgctggatactctgttgatggagcgatggca
gaacaatgtatcgttagtgcagattatgcagtaaaagttcctgaaggattagatgcaaga
caagcaacaagtattacttgtgccggagtaacaacatacaaagcaattaaagaagcaaaa
atagagccaggcgaatggattgttatttacggtgccggaggacttggtaacctagcaatt
caatatgctaaaaaagtatttaattttaaagttattgcagttgatataaatgatgataaa
ttagcattagcaaaagagacaggtgcagatttaatctttaattcaacagatcaagatcca
gcagaatggattcaaaaagaagtaggtggcgcacatgccgcagttgtaacagctgtttca
aaagttgcatttaaacaagctgttgattcagtacgtcctactgctagagtagtaaacgtt
ggtctaccacctgaaacaatggatttagatataattaaatcagtactagacggcattcaa
gtagttggttcattagttggaacgcgtaaagatcttgaagaagcatttatgtttggcgca
gaaggtaaggttgtcccagttgtccaaacgcgtcgattagatgaaatcaatgaaatattc
gaagaaatggaaaaaggaactattaatggccgtatggttcttgacatgtcactaaaataa

DBGET integrated database retrieval system