KEGG   Amphibacillus xylanus: AXY_16180Help
Entry
AXY_16180         CDS       T02266                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
axl  Amphibacillus xylanus
Pathway
axl00010  Glycolysis / Gluconeogenesis
axl00020  Citrate cycle (TCA cycle)
axl00620  Pyruvate metabolism
axl01100  Metabolic pathways
axl01110  Biosynthesis of secondary metabolites
axl01120  Microbial metabolism in diverse environments
axl01130  Biosynthesis of antibiotics
axl01200  Carbon metabolism
Module
axl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_16180 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AXY_16180 (pdhC)
   00620 Pyruvate metabolism
    AXY_16180 (pdhC)
Enzymes [BR:axl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXY_16180 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAM47750
UniProt: K0IYX9
Position
complement(1658479..1659762)
Genome map
AA seq 427 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKEGEVINEDDVLCEIQNDKAVVEIPSPVEGPVLKIH
FEEGEVATVGQTIITIDAEGYEDEGGSDTEEPEVEKSQEAEATPAKAEESKAQEKTTEVE
DPTKRVIAMPSVRKFARDNDVDIRQVKGTGKNGRVLKADIEAFINGDQPVAETAQAETVA
EATSAPKQVVPTGALPETREKMSTVRKAIAKAMVNSKHKAPHVVLHDEVDVTELVAHRTK
FKTIAQEQDVKLTYLPYVVKALVSALKKYPILNSYIDDETDEIVTKHYYNIGIAADTERG
LLVPVVKDADRKSLFDISRDISELAQKAHDFKLSPEEMSGASSTISNIGSAGGQWFTPII
NYPEAAILGIGRIAEKPIVRNGEIVAAPVLAISLSFDHRIVDGATAQHALNQIKRLLNDP
QLIMMEA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaatttaaattgcccgacattggcgaaggtatccatgaaggtgaaatcgtc
aagtggtttgttaaagaaggcgaagtaatcaatgaagacgacgtattatgtgagattcaa
aacgataaagcagttgtagaaatcccatctccagtagaaggtccggtattgaagattcac
tttgaagagggagaagttgcaactgtaggtcaaacaattatcactattgatgcagaaggt
tatgaagacgaaggtggtagcgatacagaagagccggaagtagagaaatctcaagaagct
gaagctacacctgcaaaagccgaagaaagtaaagcacaagaaaaaacgacagaagtagaa
gatcctacaaaacgtgtaattgcaatgccatctgtacgcaaatttgctcgtgataatgat
gtagatattagacaggtaaaaggtacaggtaagaatggccgtgtattaaaagcggacatt
gaagcatttattaatggagaccaacctgtagctgaaacagctcaagcagaaacagttgct
gaagcaacttcagcaccaaaacaagttgtacctactggtgctttaccagaaactagagag
aagatgtcaactgttcgtaaagcaattgctaaagcaatggttaactctaaacataaagca
cctcacgttgtactacatgatgaggttgatgtaactgaattagttgctcaccgtactaag
tttaagacaattgcacaggaacaagatgtgaagttaacatacttaccttatgttgttaaa
gcacttgtttcagcattgaagaaatatccaatcttaaactcatatattgatgatgaaact
gacgaaatcgttacaaagcattactataatattggtattgctgctgatacagagagaggt
ctacttgttccagttgttaaggatgcagatcgtaagtcgctatttgacatctcaagagat
attagcgaattagctcaaaaagcacatgactttaagctatcacctgaggaaatgtcagga
gcttcaagtacaatttctaacatcggatcagctggtggacaatggtttacaccgatcatc
aattatcctgaagcagctattttaggaattggtcgaattgctgaaaaaccaatcgttaga
aatggtgaaatcgtggctgcgccagtattagctatttcacttagctttgatcatcgtatc
gttgatggagcgactgcacagcatgctttaaatcaaattaaacgattattgaatgatcca
caattaattatgatggaggcgtaa

DBGET integrated database retrieval system