KEGG   Amphibacillus xylanus: AXY_18360Help
Entry
AXY_18360         CDS       T02266                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
axl  Amphibacillus xylanus
Pathway
axl00010  Glycolysis / Gluconeogenesis
axl00051  Fructose and mannose metabolism
axl00562  Inositol phosphate metabolism
axl01100  Metabolic pathways
axl01110  Biosynthesis of secondary metabolites
axl01120  Microbial metabolism in diverse environments
axl01130  Biosynthesis of antibiotics
axl01200  Carbon metabolism
axl01230  Biosynthesis of amino acids
Module
axl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
axl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_18360 (tpiA)
   00051 Fructose and mannose metabolism
    AXY_18360 (tpiA)
   00562 Inositol phosphate metabolism
    AXY_18360 (tpiA)
Enzymes [BR:axl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AXY_18360 (tpiA)
Exosome [BR:axl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AXY_18360 (tpiA)
  Exosomal proteins of bladder cancer cells
   AXY_18360 (tpiA)
  Exosomal proteins of melanoma cells
   AXY_18360 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC CsbD
Motif
Other DBs
NCBI-ProteinID: BAM47968
UniProt: K0J7U3
Position
complement(1909458..1910216)
Genome map
AA seq 252 aa AA seqDB search
MRKPIIAGNWKMNKVLAEAKSFVTDTKDKVPAQDQVDSIVCAPFPYLQALVEETKGTDLK
VAAQNMHYEESGAFTGEVSPLMLKDLGVEYVVLGHSERREYFAETDETVNKKAHAAFAHG
ITPIICVGETLEQREANQTMDLVAGQVKKAIAGLTDDQVKASVIAYEPIWAIGTGKTATS
EQANEVCTHIRETIAEVVSKEVAEAVRIQYGGSVKPDNIKELLDQSDIDGALVGGASLEA
DSFLQLVEAGVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaagatgaacaaggtattagcagaagcgaaa
agtttcgtaactgatacgaaagataaagtaccagcgcaagatcaggtcgactcaattgta
tgtgcaccttttccatatttacaagcactagttgaagagactaagggcacagacttaaaa
gttgcagctcaaaatatgcattacgaagaaagcggtgcttttactggagaagtaagccca
ttaatgcttaaagatcttggcgttgagtatgtagtgcttggtcactctgagcgtcgtgaa
tattttgcagaaacagatgaaactgtaaacaaaaaagctcatgctgcatttgcacatggt
attacaccaattatttgtgttggtgaaactttagaacaacgtgaagcaaatcaaacaatg
gatttagtagctggtcaagtgaaaaaagccattgctggtttaacagatgatcaagtaaaa
gcttctgttattgcttacgaaccaatttgggcgattggtactggtaaaacagcaacttca
gagcaagctaacgaagtgtgtacacatattcgtgaaacaattgctgaagttgtatcaaaa
gaagtggctgaagctgtacgaattcaatatggtggcagtgtgaagcctgacaacatcaaa
gaattattagatcaatcagacatcgatggagcactagtaggaggggcgagcttagaagct
gactcattcctacaattagtagaggctggtgtaaaatga

DBGET integrated database retrieval system