KEGG   Amphibacillus xylanus: AXY_18360Help
Entry
AXY_18360         CDS       T02266                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
axl  Amphibacillus xylanus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AXY_18360 (tpiA)
   01230 Biosynthesis of amino acids
    AXY_18360 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_18360 (tpiA)
   00051 Fructose and mannose metabolism
    AXY_18360 (tpiA)
   00562 Inositol phosphate metabolism
    AXY_18360 (tpiA)
Enzymes [BR:axl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AXY_18360 (tpiA)
Exosome [BR:axl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AXY_18360 (tpiA)
  Exosomal proteins of bladder cancer cells
   AXY_18360 (tpiA)
  Exosomal proteins of melanoma cells
   AXY_18360 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1909458..1910216)
Genome map
AA seq 252 aa AA seqDB search
MRKPIIAGNWKMNKVLAEAKSFVTDTKDKVPAQDQVDSIVCAPFPYLQALVEETKGTDLK
VAAQNMHYEESGAFTGEVSPLMLKDLGVEYVVLGHSERREYFAETDETVNKKAHAAFAHG
ITPIICVGETLEQREANQTMDLVAGQVKKAIAGLTDDQVKASVIAYEPIWAIGTGKTATS
EQANEVCTHIRETIAEVVSKEVAEAVRIQYGGSVKPDNIKELLDQSDIDGALVGGASLEA
DSFLQLVEAGVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaagatgaacaaggtattagcagaagcgaaa
agtttcgtaactgatacgaaagataaagtaccagcgcaagatcaggtcgactcaattgta
tgtgcaccttttccatatttacaagcactagttgaagagactaagggcacagacttaaaa
gttgcagctcaaaatatgcattacgaagaaagcggtgcttttactggagaagtaagccca
ttaatgcttaaagatcttggcgttgagtatgtagtgcttggtcactctgagcgtcgtgaa
tattttgcagaaacagatgaaactgtaaacaaaaaagctcatgctgcatttgcacatggt
attacaccaattatttgtgttggtgaaactttagaacaacgtgaagcaaatcaaacaatg
gatttagtagctggtcaagtgaaaaaagccattgctggtttaacagatgatcaagtaaaa
gcttctgttattgcttacgaaccaatttgggcgattggtactggtaaaacagcaacttca
gagcaagctaacgaagtgtgtacacatattcgtgaaacaattgctgaagttgtatcaaaa
gaagtggctgaagctgtacgaattcaatatggtggcagtgtgaagcctgacaacatcaaa
gaattattagatcaatcagacatcgatggagcactagtaggaggggcgagcttagaagct
gactcattcctacaattagtagaggctggtgtaaaatga

DBGET integrated database retrieval system