KEGG   Amphibacillus xylanus: AXY_19490Help
Entry
AXY_19490         CDS       T02266                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
axl  Amphibacillus xylanus
Pathway
axl00010  Glycolysis / Gluconeogenesis
axl00030  Pentose phosphate pathway
axl00051  Fructose and mannose metabolism
axl00052  Galactose metabolism
axl00680  Methane metabolism
axl01100  Metabolic pathways
axl01110  Biosynthesis of secondary metabolites
axl01120  Microbial metabolism in diverse environments
axl01130  Biosynthesis of antibiotics
axl01200  Carbon metabolism
axl01230  Biosynthesis of amino acids
axl03018  RNA degradation
Module
axl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_19490 (pfkA)
   00030 Pentose phosphate pathway
    AXY_19490 (pfkA)
   00051 Fructose and mannose metabolism
    AXY_19490 (pfkA)
   00052 Galactose metabolism
    AXY_19490 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AXY_19490 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AXY_19490 (pfkA)
Enzymes [BR:axl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AXY_19490 (pfkA)
Protein phosphatases and associated proteins [BR:axl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AXY_19490 (pfkA)
Messenger RNA biogenesis [BR:axl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AXY_19490 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAM48081
UniProt: K0J5A1
Position
complement(2028834..2029790)
Genome map
AA seq 318 aa AA seqDB search
MKKIAILTSGGDSQGMNSAIRAVTRSALANNFEVYGVRRGFKGLIDNDFVKLGTKEVSDI
LYRGGTFLQSARSESFKTPEGQAKGVENLKAKGIDYVVVIGGDGSYRGAQALHRHGIKTY
GLPGTIDNDIPLTDYTIGFDTTLNLVTDLVGNLRDTMSSHERVSVIETMGRNCGDIALQA
GIASGVDAILIPEVEPDLEKVAASVKAGFDRGKSHSIIIVAEGAGEAPEVAKKIKELSGL
DTRATVLGHIQRGGSPSSFDRVFSSRLGHRVIELIQEGITGVGLGIESNQLTHHTFDEIF
NAKNTIDLKLYQIFQDLV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatagctatattaacttcaggtggcgattcgcaaggaatgaatagtgcgatt
cgtgccgtaacaagaagtgcgcttgctaataatttcgaggtatatggagttcgaagaggt
tttaaaggattaattgataatgattttgttaaattaggaactaaagaggttagtgatatt
ttatatcgcggtggaacgttcttacaatcagcacgttcagaatcttttaaaacaccagaa
ggacaagctaaaggtgttgagaatttaaaagcaaaaggaattgactatgttgttgttatt
ggtggtgacggtagttatcgcggtgcgcaagcgcttcaccgtcacggcatcaagacatat
ggtcttccaggtactattgataatgatattccactgactgattatacaatcggttttgat
acaacattaaacttagtaacagatttagttggtaatttacgtgacacaatgagtagtcac
gaacgtgttagtgtcattgagacaatgggacgtaattgtggagacatcgcattgcaagca
ggtattgcaagtggtgttgatgcaattttaattcctgaagttgaaccagatttagaaaaa
gttgcagcaagtgttaaagctggttttgatcgtggtaaatcacatagtatcattattgtt
gctgaaggtgctggagaagctcctgaggtagcgaaaaagattaaagaactgtcaggatta
gatactcgtgcaactgttcttggtcatattcaacgtggtggttcaccaagctcatttgac
cgtgtcttctcaagtcgactgggtcatcgtgttattgaattaattcaagagggcattact
ggtgttggtttagggattgaaagtaatcaactgacgcaccatacttttgatgaaattttt
aacgctaagaacacaattgacttgaagctatatcaaattttccaagatttagtataa

DBGET integrated database retrieval system