KEGG   Amphibacillus xylanus: AXY_19490Help
Entry
AXY_19490         CDS       T02266                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
axl  Amphibacillus xylanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AXY_19490 (pfkA)
   01230 Biosynthesis of amino acids
    AXY_19490 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_19490 (pfkA)
   00030 Pentose phosphate pathway
    AXY_19490 (pfkA)
   00051 Fructose and mannose metabolism
    AXY_19490 (pfkA)
   00052 Galactose metabolism
    AXY_19490 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AXY_19490 (pfkA)
Enzymes [BR:axl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AXY_19490 (pfkA)
Protein phosphatases and associated proteins [BR:axl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AXY_19490 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2028834..2029790)
Genome map
AA seq 318 aa AA seqDB search
MKKIAILTSGGDSQGMNSAIRAVTRSALANNFEVYGVRRGFKGLIDNDFVKLGTKEVSDI
LYRGGTFLQSARSESFKTPEGQAKGVENLKAKGIDYVVVIGGDGSYRGAQALHRHGIKTY
GLPGTIDNDIPLTDYTIGFDTTLNLVTDLVGNLRDTMSSHERVSVIETMGRNCGDIALQA
GIASGVDAILIPEVEPDLEKVAASVKAGFDRGKSHSIIIVAEGAGEAPEVAKKIKELSGL
DTRATVLGHIQRGGSPSSFDRVFSSRLGHRVIELIQEGITGVGLGIESNQLTHHTFDEIF
NAKNTIDLKLYQIFQDLV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatagctatattaacttcaggtggcgattcgcaaggaatgaatagtgcgatt
cgtgccgtaacaagaagtgcgcttgctaataatttcgaggtatatggagttcgaagaggt
tttaaaggattaattgataatgattttgttaaattaggaactaaagaggttagtgatatt
ttatatcgcggtggaacgttcttacaatcagcacgttcagaatcttttaaaacaccagaa
ggacaagctaaaggtgttgagaatttaaaagcaaaaggaattgactatgttgttgttatt
ggtggtgacggtagttatcgcggtgcgcaagcgcttcaccgtcacggcatcaagacatat
ggtcttccaggtactattgataatgatattccactgactgattatacaatcggttttgat
acaacattaaacttagtaacagatttagttggtaatttacgtgacacaatgagtagtcac
gaacgtgttagtgtcattgagacaatgggacgtaattgtggagacatcgcattgcaagca
ggtattgcaagtggtgttgatgcaattttaattcctgaagttgaaccagatttagaaaaa
gttgcagcaagtgttaaagctggttttgatcgtggtaaatcacatagtatcattattgtt
gctgaaggtgctggagaagctcctgaggtagcgaaaaagattaaagaactgtcaggatta
gatactcgtgcaactgttcttggtcatattcaacgtggtggttcaccaagctcatttgac
cgtgtcttctcaagtcgactgggtcatcgtgttattgaattaattcaagagggcattact
ggtgttggtttagggattgaaagtaatcaactgacgcaccatacttttgatgaaattttt
aacgctaagaacacaattgacttgaagctatatcaaattttccaagatttagtataa

DBGET integrated database retrieval system