KEGG   Amphibacillus xylanus: AXY_20100Help
Entry
AXY_20100         CDS       T02266                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
axl  Amphibacillus xylanus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AXY_20100 (gtaB)
   00052 Galactose metabolism
    AXY_20100 (gtaB)
   00500 Starch and sucrose metabolism
    AXY_20100 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    AXY_20100 (gtaB)
Enzymes [BR:axl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AXY_20100 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2103802..2104689)
Genome map
AA seq 295 aa AA seqDB search
MAKVKKAIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKG
KRAIEDHFDFAPELEQNLKAKNKLDLLHKVEQSTNLADIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVESDVPCLKQLINQFEDKQSSVIGVQQVPEALTERYGIVDPGAKVN
GRLYEVDHFVEKPPLGTAPSNLAIMGRYVFTPEIFRFLERHQIGAGGEIQLTDAIQMLNE
IQKVYAYDFQGRRYDVGEQLGFIETTIEFALKNKEIGEDVKKLLFDLTDQLRAEE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagtaaaaaaagcaattatcccagcagccggtctagggactcggtttttacca
gtgacaaaggcgatgccgaaagaaatgttaccaattgttgataaaccgacaattcaatac
atcgtcgaggaagcagttgcttcgggcatcgaagatattattatcgtaaccggaaaaggt
aaacgtgcgattgaggatcactttgatttcgcaccagagcttgagcaaaatctaaaggct
aaaaacaaactagatttgttacataaagttgagcaatctacaaatttagcggatattcac
tatattcgtcaaaaagaaccaaaaggtcttggacatgcagtttggtgtgctcgtaaattt
atcggtgatgagccatttgcggtgctactcggtgatgatattgttgaaagtgacgtacca
tgcttaaaacaattgattaatcaatttgaagataaacaatcatcagtgattggtgttcaa
caagtgccagaagcattaactgaacgctacggaatcgtagatccaggtgcaaaggtgaat
ggtcgactctatgaagtggatcattttgttgagaagccaccactaggtactgcaccatca
aatctagcgattatgggacgctacgtgtttacacctgaaattttccgattcttagagcgt
catcaaatcggtgcaggtggagaaattcaattaacagacgcaatccaaatgttaaatgaa
attcagaaagtatacgcctatgacttccaaggacgtcgctacgatgtaggggaacaactc
ggtttcattgaaacgacgattgaattcgcactgaaaaataaagaaatcggcgaagatgtt
aaaaagctcctgtttgatttaacagatcaactaagagcagaagaataa

DBGET integrated database retrieval system