KEGG   Amphibacillus xylanus: AXY_21060Help
Entry
AXY_21060         CDS       T02266                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
axl  Amphibacillus xylanus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXY_21060 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXY_21060 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXY_21060 (trpA)
Enzymes [BR:axl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AXY_21060 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2212954..2213739)
Genome map
AA seq 261 aa AA seqDB search
MTISKLESALKQTLASGNKIFIPYIMAGDGGLDQLPEQIAFLAETGATAIELGIPFSDPV
ADGPVIQEAGLRALSLGANLRSILAILEETKHERTIPIVLMSYFNPIFAYGLEACLQDCR
RAGVSGLIIPDLPIEEEGIIPELFAREELGLIRLATLTSSSDRLEKIAEKTTGFLYAVTV
TGTTGERHQYIDSIGEYLSKLKQISKKPVVAGFGVSTPEQVKRLSQYCDGVIVGSKIVKS
LHKNDRQSITELIGATKLTNN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgattagtaagctagaatcagcattaaagcaaacattagcaagcggtaataaaatc
tttatcccatatattatggcaggggatggtgggcttgatcagctacctgaacaaatagca
tttttagcggagactggtgcaacagctattgagctagggattccattttctgatccagtc
gccgatggacctgttatccaagaagcaggacttagggcattatctttaggtgctaatctt
cgatctattttggcaattctagaagaaacaaagcatgaacgaacgattccaattgtctta
atgagttattttaatccgatattcgcttatggcctagaggcttgtcttcaagattgtcgt
cgagcgggcgtttcgggattaattattccggacttaccaattgaagaggaagggattatt
cctgaattgtttgctcgtgaagaacttggcttgattcgacttgcgacattaacgagctca
tctgatcgtctggaaaaaattgctgaaaaaacgactggatttttatatgctgtcactgtg
actggtacaacgggagaacgtcatcaatatattgattcgattggcgaatatttatctaaa
ctcaagcaaatcagtaaaaaaccagttgttgctggctttggcgtctcgacaccagaacaa
gtgaagcggttaagccaatattgtgatggtgtgattgttggtagtaaaatcgttaaatct
ttacacaaaaacgaccgtcaatcaattactgaactaattggagcgactaaattgacgaat
aactag

DBGET integrated database retrieval system