KEGG   Amphibacillus xylanus: AXY_21070Help
Entry
AXY_21070         CDS       T02266                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
axl  Amphibacillus xylanus
Pathway
axl00260  Glycine, serine and threonine metabolism
axl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
axl01100  Metabolic pathways
axl01110  Biosynthesis of secondary metabolites
axl01130  Biosynthesis of antibiotics
axl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXY_21070 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXY_21070 (trpB)
Enzymes [BR:axl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AXY_21070 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAM48239
UniProt: K0J0A1
Position
complement(2213729..2214937)
Genome map
AA seq 402 aa AA seqDB search
MSIYQKPDQSGHFGLFGGRFVPETLMPAVLELEQAYEAAIDDPIFQQQLSYYLSQYVGRE
TPLYFAERLTKMLGGARIYLKREDLNHTGAHKINNALGQALLTLRMGKKKIVAETGAGQH
GVATATVSALLGLECIIFMGEEDIRRQKLNVFRMELLGAKVVSVSQGSGTLKDAVNEALR
YWVTNVEDTHYIIGSVVGPHPFPKIVRDFQSVIGTEAKRQFEQEYGGLPDAIVACIGGGS
NAMGLFYPFIDDQTVKIYGVEAGGLGVETGKHSAALTDGKAGVLHGMMTYLLQDQHGQIQ
AATSISAGLDYPGVGPEHSFLKDINRVQYVSVTDHEALAGLKLLSETEGIIPALESAHAI
AYLEKLAPKMSQDESIIVCLSGRGDKDVETVQSALGGGQNDD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatatcaaaaaccagatcaaagtggacattttggcttgtttggggggcgattt
gtccctgaaacgttaatgccagcagtacttgagttagaacaggcttatgaagcggcaatt
gatgatccgattttccaacagcaactaagctactatttatctcaatacgttgggcgagaa
acaccgctttactttgcagaacgtttaacgaaaatgctaggtggtgcgaggatttactta
aagcgtgaagatttaaatcatacaggcgcacataagattaataatgcactcgggcaagca
ttgttaactttaagaatgggtaagaaaaaaattgtcgcagaaacaggagcgggtcaacat
ggtgtcgcaacagcgacagtgtcagccttattaggattagagtgcattatttttatgggt
gaagaagatattcgtagacaaaagctcaatgtttttagaatggagttacttggagcaaag
gttgtgagtgttagtcaaggcagtggcacgctaaaagatgcagtcaatgaagcacttcgc
tattgggtaacaaatgtagaggatactcattatattattggttcagtcgtaggtccgcat
ccatttcctaaaatagtccgtgattttcaaagtgtgattggcacagaagcaaaacgacaa
tttgaacaagagtatggtgggcttcctgatgcaatcgtcgcttgtattggtggtggtagt
aatgcgatgggattattttatccgtttattgacgatcaaaccgtaaaaatttacggggta
gaagcgggcggattaggtgtcgaaactggaaaacattccgctgctttaactgatggaaaa
gcgggtgtgctacatggtatgatgacatacctacttcaagatcaacatggtcaaattcaa
gcagcgacatcaatttcggctggattggattatccaggagtcggaccagagcatagcttt
ttaaaagacattaatcgtgttcaatatgtatcagttaccgatcatgaggcgttggcgggg
ttaaaattgctatcagaaacggaagggataattccagcgttagaaagtgctcacgcaatt
gcttacttagaaaagctcgcaccaaaaatgagtcaagacgaatcgatcattgtctgtcta
tctggacgtggtgataaagatgttgaaacagtacagtcagctttagggggtgggcaaaat
gacgattag

DBGET integrated database retrieval system