KEGG   Amphibacillus xylanus: AXY_21220Help
Entry
AXY_21220         CDS       T02266                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
axl  Amphibacillus xylanus
Pathway
axl00010  Glycolysis / Gluconeogenesis
axl00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_21220
   00500 Starch and sucrose metabolism
    AXY_21220
Enzymes [BR:axl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     AXY_21220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: BAM48254
UniProt: K0J0B8
Position
2234056..2235501
Genome map
AA seq 481 aa AA seqDB search
MEHKQLKPFPSDFLWGSASAAYQVEGAYDQDGKGPSVWDIYTKIPGTTFKNTNGDVAVDH
YNRYKEDVALMAEQGLKAYRFSIAWSRIYPEGRGEVNEAGLKFYDRLIDELIKHNIEPLI
TIYHWDVPQALMDAYGAWESREIIEDFNTYCETLFKHYGDRVKYWVTLNEQNIFIGLGYR
SGLHPPGVKDLKRMYQANHIANIANAKAIETFRKIVKDGKIGPSFAYSPAYPLDSKPENI
IAAENAEEINAHWWMDVYAWGHYPKTMWNYLESEGLTPEIEPGDFELLKRAKPDFMGLNY
YQTSTFEANPLDGVGEAEMNTTGKKGTSKASGHPGLFKYVKNPYAETTDWDWTIDPEGLR
VALRRINNRYQLPVLITENGLGAFDTLEEGDVVNDDYRIDYLESHVAAIQNAISDGVDVL
GYCTWSFTDLLSWLNGYQKRYGFVYVNRDESGPKDLRRVKKKSFYWYQEVIKANGLINRE
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaacaactaaagccattcccatcagatttcttatggggatctgcctctgct
gcgtatcaagttgaaggcgcttacgaccaggatggcaaagggccatcagtctgggatatc
tacacaaaaatccctggaactacatttaaaaacactaacggtgacgttgccgttgatcac
tacaatcgttataaagaagatgttgctttaatggctgaacaagggttaaaagcataccgc
ttttccatcgcttggagccggatttatccagaaggccgtggtgaggtcaatgaagcaggt
ttaaaattttacgatcgtttaatagatgaactcattaagcataatattgagcctctcatt
actatttaccattgggacgtaccacaagcattgatggatgcgtatggtgcatgggaatca
agagaaattattgaggattttaacacatattgcgagacattatttaaacattacggtgat
cgggtaaaatattgggttacattgaatgaacaaaatatttttatcggtcttggctatcgt
tcaggtctacacccaccaggagtaaaagatttaaagagaatgtatcaagctaaccatatc
gctaacattgcaaatgctaaagcaattgaaacattccgtaagattgttaaagatgggaaa
attggtccaagctttgcatacagccctgcatatccacttgatagtaagccagaaaacatt
attgcagcagaaaatgcagaagaaattaatgcacattggtggatggatgtctatgcatgg
ggacactatccgaaaacaatgtggaattatcttgagtctgaaggtcttacaccagagatt
gaacctggcgattttgaattattaaagcgagctaaaccagattttatgggactcaactat
taccaaactagtacatttgaagcgaacccactcgatggtgtaggtgaagctgagatgaat
acgaccggtaagaaaggtacttctaaggcatcaggtcacccaggattatttaaatatgtt
aaaaacccatatgctgaaacgacagattgggattggacaattgatcctgaaggcttacgt
gttgctttgcggagaattaacaatcgctatcagttacctgttctaattactgaaaatgga
ttaggtgcatttgacacgcttgaagaaggcgatgtcgtaaatgatgattatcgaattgac
tatctcgaatctcacgttgcagcgattcaaaacgcaatatcagatggtgttgacgtactt
ggatattgtacatggtcatttactgacttattaagttggctaaatggatatcaaaaacgt
tacggttttgtttatgttaatcgtgatgaatctggaccgaaagatttacgtagagttaag
aagaagagtttttactggtatcaagaagttattaaagcgaacggtttgattaatcgtgag
aaataa

DBGET integrated database retrieval system