KEGG   Amphibacillus xylanus: AXY_22090Help
Entry
AXY_22090         CDS       T02266                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
axl  Amphibacillus xylanus
Brite
Enzymes [BR:axl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AXY_22090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2336480..2337634
Genome map
AA seq 384 aa AA seqDB search
MFKNLLIDYLQKHLIKIPKNKEERQLKRIRKPLLVGILVCLALGLSAITVFAAITNNEIG
THDGYDYEFWKDYGGSGSMTLNSGGTFTAQWSNVNNILFRKGKKFDQTQTHQQIGNMSID
FGVNYQPSGNSYLTVYGWTVDPLVEYYIVDSWGNWRPPGATPKGTVYVDGDTYDIYETTR
YNQPSIIGDTTLQQYWSVRRNKRTSGTISVTDHFNAWERHGMPMGKMYEVALTIEGYQSS
GYADVYRNDLHIGGSGGGGTPGNGQVTRIEAETMSINGPYAGPISSPFDGVALYANNDSV
KFTHYFDSNNNSFSLRGASNNNNMARADLRIGGQTVGTFYYGDHYPAVYTINNVYHGTGF
QEVELIVTADDGTWDAFIDYLEIH
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgttcaaaaatctattgattgactacttacagaagcatctgatcaaaatcccaaaaaat
aaggaggaaagacagttgaaacgaattagaaaaccactgttggtcggtattttagtttgt
ttagcactaggattatcagcaatcactgtatttgccgcaataactaacaatgagattggc
acacatgatggctatgactatgaattttggaaagattatggtggttctggtagtatgaca
cttaatagtgggggaacttttactgcccaatggagtaatgttaacaacatcctattccgt
aagggtaaaaagtttgaccaaacacaaacacaccaacaaattggcaatatgtcaattgac
tttggcgtaaactatcagccttccggaaactcttatttaacagtatacggttggacagtt
gatccattagttgaatattatattgttgatagttgggggaattggagacctcctggagca
acaccaaaagggacggtttatgttgatggtgatacgtacgacatttatgagacgacacga
tacaatcaaccatcgattatcggtgacacaactttacaacagtattggagcgtaagacgt
aacaaacgtacaagcgggacaatctcagtaacagatcacttcaatgcttgggaaagacac
ggtatgccaatgggtaaaatgtatgaagttgctctaacgatcgaaggatatcagagcagc
ggttatgctgatgtctacagaaatgatctccacataggtggtagtggcggaggtggcaca
ccaggtaatggacaagtgacacgaatcgaagctgaaacaatgtcaattaatggcccatat
gctggaccaataagttctccatttgatggtgtggctctttatgcaaataacgactcagtg
aagttcactcattatttcgacagcaataacaacagtttttcattgcgaggtgcttctaac
aataataatatggcacgggccgatttaagaattggtggacaaactgtcggtacattctat
tatggagatcattatcctgcggtctatacaattaataacgtttatcacggtacgggattc
caagaagttgaattaattgtaactgcagatgatggcacttgggatgcctttatcgattat
ttagaaattcactaa

DBGET integrated database retrieval system