KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_0860Help
Entry
AX27061_0860      CDS       T02964                                 

Definition
Esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Brite
Enzymes [BR:axn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AX27061_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
912996..913859
Genome map
AA seq 287 aa AA seqDB search
MTTPRTGALLIHGLGGTEFDMGSLHKVLARAGVETHGVTLPGHAGRPEDLLDVRVEDWMD
VVTRRYRELCEQYEVVHVIGMCLGALLAVELCKRESHTRGALVSLSAPVFLDGWSTPWYR
GLRYLLYHVPGVPRRIRVEEEDPYGVKSELVRAFIKAGFARGDGFHYQWVPLACVRQVDR
LRGMVKRGLEQMRCPTLVMHAVEDELTSPRSARLLGARIPGASVVLLQDSYHMICVDHER
ERVMQNVLAFLGKDPGIVRVRRRAAESRRTRGATAPDEAQGLLVAAR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgcctcgcaccggagcgctgctgatccatggcctgggcggcaccgaattcgac
atgggctcgctgcacaaggtgctggcgcgcgcgggagtggaaacccatggcgtgacgttg
cccggccacgccggccggcccgaggacctgctggacgtgcgggtcgaggactggatggac
gtggtgacgcgccgctaccgcgagttgtgcgagcagtacgaagtcgtgcacgtcatcggc
atgtgcctgggcgcgctgctggccgtggagctgtgcaaacgcgaatcgcatacccggggc
gcgctggtgtcgctgtccgcgcccgtgttcctggatggctggagcacgccgtggtatcgc
ggcctgcgctacctgctttaccacgtgccgggggtgccgcgccgcatccgggtcgaggaa
gaagacccctacggcgtcaagagcgaactggtgcgggccttcatcaaggccggcttcgcg
cggggcgacggcttccattaccaatgggtgccgctggcctgcgtgcgccaggtcgaccgg
ttgcgcggcatggtcaagcgcgggctggagcagatgcgctgcccgacgctggtgatgcac
gcggtcgaggacgagctgaccagcccgcgttcggcgcgcctgctgggcgcgcggattccc
ggcgcgtcggtggtgttgctgcaggacagttaccacatgatctgcgtggatcacgagcgc
gagcgcgtgatgcagaacgtgctggcattcctgggcaaggatccgggcatcgtgcgtgtg
cggcggcgcgccgcagaatcgcggcgaacccgcggcgcaaccgcgccggacgaggcgcaa
ggcctgctggtggccgcccgctag

DBGET integrated database retrieval system