KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_3845Help
Entry
AX27061_3845      CDS       T02964                                 

Definition
Fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:axn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:axn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4251482..4252690)
Genome map
AA seq 402 aa AA seqDB search
MDYILSFIAGGLTQATWWQIVVFTLVMTHITIVSVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPILFGIWKVLFRGAELYREESNNKETMA
KFGHGTPDDWLERNVYSKHSLWGVLTMLAIDIALFGAIGVTVWAVQMAWIPFWAAGVVNG
IGHYWGYRNYNSPDTSTNVFPWGIVIGGEELHNNHHAHGTSAKFSAKWYEFDIGWCYINI
LKFLGLAKIKKVAPKLKLDDSKTGIDLRTLQGVITHRYEVMARYADVIKSAAREELAKLK
ASRQDGNAECGWNKLHKVRRAIHRNEDILQPEQLEAVDKAIAQNKSLSTLVQMRRELGRI
WESSSASSEQLLHDLQAWCQRAQQSGIAGLEQFAQRLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattacatcctctccttcattgccggcggtttgacccaagccacttggtggcagatc
gtcgttttcaccctggtcatgacgcacatcaccattgtgtccgtcaccgtcttcctgcac
cgcagccaggcgcaccggggcctggatctgcatccggccgtcatgcacttcttccgcttc
tggctctggatgacgaccggcatggtcaccaaggaatgggttgccatccaccgcaagcat
cacgccaagtgcgaaaaggaaggcgatccccattcgcccatcctgttcggcatctggaag
gtgctgttccgcggcgccgagctctaccgcgaagaatccaacaacaaggaaaccatggcc
aagttcggccacggcacgcctgacgactggctcgaacgcaacgtctacagcaagcacagc
ctgtggggcgtgctgaccatgctcgccatcgacatcgccctgttcggcgcgatcggcgtc
acggtgtgggcggtgcagatggcctggattcccttctgggcggccggcgtcgtcaacggc
atcggccactactggggctatcgcaactacaacagcccggacaccagcaccaacgtgttc
ccgtggggcatcgtgatcggcggcgaagagctgcacaacaaccaccacgcccacggcacg
tcggccaagttctcggccaagtggtacgagttcgacatcggctggtgctacatcaacatc
ctgaagttcctgggcctggccaagatcaagaaggtcgcgcccaagctcaagctggatgac
tccaagaccggcatcgacctgcgcacgctgcaaggcgtgatcacgcaccgctacgaagtc
atggcccgctacgcggacgtgatcaagagcgccgcccgcgaggaactggccaagctgaag
gcctcgcgccaggacggcaacgccgaatgcggctggaacaagctgcacaaggtgcgccgc
gccatccaccgcaacgaggacatcctgcaaccggagcaactcgaagccgtggacaaggcc
atcgcccagaacaagtcgctgtcgacgctggtgcagatgcgccgcgaactcggccgcatc
tgggaaagctccagcgccagcagcgaacagcttctccatgacctgcaggcctggtgccag
cgcgcccagcaaagcggcatcgccgggctcgagcaattcgctcaacgtctgcgccgctac
gcggcatga

DBGET integrated database retrieval system