KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_3845Help
Entry
AX27061_3845      CDS       T02964                                 

Definition
Fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:axn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AX27061_3845
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AX27061_3845
Enzymes [BR:axn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AX27061_3845
Lipid biosynthesis proteins [BR:axn01004]
 Desaturase
  First
   AX27061_3845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4251482..4252690)
Genome map
AA seq 402 aa AA seqDB search
MDYILSFIAGGLTQATWWQIVVFTLVMTHITIVSVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPILFGIWKVLFRGAELYREESNNKETMA
KFGHGTPDDWLERNVYSKHSLWGVLTMLAIDIALFGAIGVTVWAVQMAWIPFWAAGVVNG
IGHYWGYRNYNSPDTSTNVFPWGIVIGGEELHNNHHAHGTSAKFSAKWYEFDIGWCYINI
LKFLGLAKIKKVAPKLKLDDSKTGIDLRTLQGVITHRYEVMARYADVIKSAAREELAKLK
ASRQDGNAECGWNKLHKVRRAIHRNEDILQPEQLEAVDKAIAQNKSLSTLVQMRRELGRI
WESSSASSEQLLHDLQAWCQRAQQSGIAGLEQFAQRLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattacatcctctccttcattgccggcggtttgacccaagccacttggtggcagatc
gtcgttttcaccctggtcatgacgcacatcaccattgtgtccgtcaccgtcttcctgcac
cgcagccaggcgcaccggggcctggatctgcatccggccgtcatgcacttcttccgcttc
tggctctggatgacgaccggcatggtcaccaaggaatgggttgccatccaccgcaagcat
cacgccaagtgcgaaaaggaaggcgatccccattcgcccatcctgttcggcatctggaag
gtgctgttccgcggcgccgagctctaccgcgaagaatccaacaacaaggaaaccatggcc
aagttcggccacggcacgcctgacgactggctcgaacgcaacgtctacagcaagcacagc
ctgtggggcgtgctgaccatgctcgccatcgacatcgccctgttcggcgcgatcggcgtc
acggtgtgggcggtgcagatggcctggattcccttctgggcggccggcgtcgtcaacggc
atcggccactactggggctatcgcaactacaacagcccggacaccagcaccaacgtgttc
ccgtggggcatcgtgatcggcggcgaagagctgcacaacaaccaccacgcccacggcacg
tcggccaagttctcggccaagtggtacgagttcgacatcggctggtgctacatcaacatc
ctgaagttcctgggcctggccaagatcaagaaggtcgcgcccaagctcaagctggatgac
tccaagaccggcatcgacctgcgcacgctgcaaggcgtgatcacgcaccgctacgaagtc
atggcccgctacgcggacgtgatcaagagcgccgcccgcgaggaactggccaagctgaag
gcctcgcgccaggacggcaacgccgaatgcggctggaacaagctgcacaaggtgcgccgc
gccatccaccgcaacgaggacatcctgcaaccggagcaactcgaagccgtggacaaggcc
atcgcccagaacaagtcgctgtcgacgctggtgcagatgcgccgcgaactcggccgcatc
tgggaaagctccagcgccagcagcgaacagcttctccatgacctgcaggcctggtgccag
cgcgcccagcaaagcggcatcgccgggctcgagcaattcgctcaacgtctgcgccgctac
gcggcatga

DBGET integrated database retrieval system