KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4162Help
Entry
AX27061_4162      CDS       T02964                                 

Definition
putative ribulose-1,5-bisphosphate carboxylase
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:axn01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:axn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4611805..4613082
Genome map
AA seq 425 aa AA seqDB search
MNTQVIRATYLIETPLDPARVAEVMAGEQSCGTFTRVEGETDELRARARAQVESVQELES
ARQASLPNAWLARQPGGMPAVLRRARVRIAFPVANIGPNLPTLAATVGGNLYDLGEVTGL
RLEQLELPSDYRAQFEMPRVGVAGTRQLTGVASGALVGTIIKPNVGLSPEQTAHLVARLC
AAGVDFIKDDEVCANPAHAPLAQRVAAVMAVVRAHRERTGRQVMVAFNITDETDAMRRHA
DLIEREQGSCVMASLNWCGHSAIQTLRRHTPLALHGHRNGYGALSRHPLLGIGFQAYQTL
WRLAGVDHMHVHGLQGKFSQPDAEVVESARDCLAPLTPGIDDAVMPAFSSGQWAGTVPAT
WAAVRTDDLLFMSGGGILAHPDGPAAGVQSIRQAWQAVRAGQDLAAFAAQAPELRRALAH
FGSRA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccaagtcatccgcgccacctacctgatcgaaaccccgctggacccggcgcgc
gtcgccgaggtgatggcgggcgagcagtcctgcggcaccttcacccgcgtcgagggcgag
acagacgagctgcgggcacgcgcccgcgcccaggtcgaatcggtgcaggaactcgaatcc
gcccgccaggccagcctgcccaacgcctggctggcgcgccagccgggcggcatgccggcc
gtgctgcgccgcgcccgcgtgcgcatcgcctttccggtggccaacatcggccccaacctg
ccgaccctggccgccacggtcggcggcaacctgtacgacctgggcgaagtgaccggcctg
cggctggagcagctggaactgccgtccgactaccgcgcgcaattcgagatgccgcgggtc
ggcgtggccggcacgcgccagctgaccggcgtggccagtggcgcgctggtgggcaccatc
atcaagcccaatgtcggcctgtcgcccgagcagaccgcgcacctggtggcgcggctgtgc
gcggccggcgtggatttcatcaaggacgacgaggtctgcgccaaccccgcccatgcgccg
ctggcgcagcgcgtggccgccgtgatggcggtggtgcgggcgcaccgcgaacgcaccggc
cgacaggtgatggtggccttcaacatcaccgacgaaaccgacgccatgcggcgccacgcc
gacctgatcgaacgcgagcaaggcagctgcgtgatggccagcctgaactggtgcggccat
tccgccatccagaccctgcggcgccacacgccgctggcgctgcacggccatcgcaacggt
tacggcgcgctgtcgcgccaccccctgctgggcatcggtttccaggcctaccagacgctg
tggcggctggccggcgtggaccacatgcacgtgcacggcctgcaaggcaagttctcgcag
ccggacgcggaagtggtcgagagcgcgcgcgattgcctggccccgctcacgcccggcatc
gacgacgcggtgatgccggcgttctcgtccggccagtgggccggcacggtgcccgccacc
tgggccgcggtgcgcaccgacgacctgctgttcatgtccggcggcggcatcctggcgcat
ccggacggcccggcggccggcgtgcaaagcatccgccaggcctggcaggcggtgcgcgcc
ggccaggacctggctgccttcgccgcccaggccccggagctgcggcgcgcgctggcgcac
ttcggatcgcgcgcatga

DBGET integrated database retrieval system