KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4326Help
Entry
AX27061_4326      CDS       T02964                                 

Definition
Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:axn00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:axn00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:axn00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:axn00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4794975..4796237
Genome map
AA seq 420 aa AA seqDB search
MKNQDLNTRRSLATPRGVGVMCDFYAVRAENATLWDADGKEYIDFAGGIAVLNTGHLHPK
VKAAVSAQLDNFTHTAYQIVPYEGYVSLAERINRLAPIDGLKKSAFFTTGVEAVENAVKI
ARSATGRSGVIAFSGSFHGRTMLGMALTGKVAPYKLSFGPMPGDIYHVPFPNGTQSITVA
DSLKALDLLFKVDIDPKRVAAIIIEPVQGEGGFNITPPELMTALRKICDEHGILLIADEV
QTGFGRTGKLFAMEHHSVQADLITMAKSLGGGFPISGVVGRADVMDGPAAGGLGGTYAGN
PLAVAAAHAVLDVIAEEKLCERAVQLGDKLRARLEGLRAKVPGIADVRGLGSMVALELND
ANGKPDAEAVKKVQARAIAQGLILLSCGVYGNVLRFLYPLTIPDAQFDRALDILAESLAA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaggacctgaatacccgccgttccctggccacgccgcgcggcgtcggcgtc
atgtgtgatttctacgccgtgcgcgccgagaacgccacgctgtgggatgccgacggcaag
gaatacatcgatttcgcgggcggcatcgcggtgctgaacaccggccacctgcaccccaag
gtcaaggccgccgtcagcgcccagctcgacaacttcacccacacggcctaccagatcgtg
ccgtacgaaggctatgtgtcgctggccgagcgcatcaaccgcctggccccgatcgacggc
ctgaagaagtcggccttcttcaccaccggcgtcgaagccgtcgaaaacgccgtcaagatc
gcgcgctcggccaccggccgttcgggcgtcatcgccttctcgggctcgttccacggccgc
accatgctgggcatggcgctgaccggcaaggtcgccccctacaagctgtcgttcggcccg
atgccgggcgacatctaccacgtgccgttccccaacggcacccagtccatcaccgtggcc
gactcgctcaaggcgctggacctgctgttcaaggtcgacatcgatcccaagcgcgtcgcc
gcgatcatcatcgaaccggtgcagggcgaaggcggcttcaacatcaccccgcccgaactg
atgacggcgctgcgcaagatctgcgacgagcacggcatcctgctgatcgccgacgaagtg
cagaccggcttcggccgcaccggcaagctgttcgccatggagcaccattcggtgcaggcc
gacctgatcaccatggccaagagcctgggcggcggcttcccgatctcgggcgtggtcggc
cgcgccgacgtcatggacggcccggccgccggcggcctgggcggcacctacgccggcaac
ccgctggcggtggccgcggcccacgccgtgctggacgtgatcgccgaggaaaagctgtgc
gagcgcgccgtgcaactgggcgacaagctgcgcgcccgcctcgagggcctgcgcgccaag
gtgccgggcatcgccgacgtgcgcggcctgggttcgatggtggcgctggaactgaacgac
gccaacggcaagcccgatgccgaggcggtcaagaaggtgcaggcccgcgccatcgcgcaa
ggcctgatcttgctaagctgcggcgtgtacggcaacgtcctgcgcttcctgtaccccttg
accattcccgacgcccagttcgaccgcgcgctggacatcctggccgagtcgctggccgcc
taa

DBGET integrated database retrieval system