KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5339Help
Entry
AX27061_5339      CDS       T02964                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:axn00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    AX27061_5339
Enzymes [BR:axn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     AX27061_5339
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     AX27061_5339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5875142..5875873
Genome map
AA seq 243 aa AA seqDB search
MRWPIPAELPALVGGHTVRECGRRGKYLLLRFDHGTQIVHLGMSGSLRSVAPGEFLRKHD
HVEWIFDQAVLRLHDPRRFGAVLWHPDADGPVENHPLLAKLGIEPFDPRFDGAWLHHHFK
NHGAAIKQVLLAGMAVVGVGNIYASESLFRARINPKTPANKLSRARCDRLADMVRATLAD
ALTSGGSTLRDYVGATGEPGAYFEIHAAVYERAGQPCRVCGTPIKRIVQGQRATYYCPKC
QKT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggcccatcccggccgaactgcccgccctggttggcggccacacggtgcgcgaa
tgcggccgccgcggcaagtacctgctgctgcgcttcgaccacggcacccagatcgtgcac
ctgggcatgtccggttcgctgcgcagcgtggcgcccggtgaattcctgcgcaagcacgac
cacgtcgaatggatcttcgaccaggcggtgctgcgcctgcacgacccgcgccgcttcggc
gcggtgttgtggcatcccgatgcggacggaccggtcgaaaaccaccccctgctggccaag
ctcggcatcgagccattcgacccgcgcttcgacggcgcctggctgcaccatcacttcaag
aaccacggcgccgcgatcaagcaagtgctgctggccggcatggcggtggtgggtgtgggc
aatatctatgcctccgaaagcctgttccgcgcgcgcatcaatcccaagaccccggccaac
aagctgtcgcgcgcccgctgcgaccgcctggcggacatggtgcgcgccaccctggccgac
gccctgacctccggcggcagcaccctgcgcgactacgtcggcgccaccggcgagccgggc
gcctatttcgagatccacgccgcggtctatgaacgcgccggccagccctgccgggtctgc
ggcacgccgatcaagcgcatcgtccagggccagcgggccacctactactgcccgaagtgc
cagaagacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system