KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5614Help
Entry
AX27061_5614      CDS       T02964                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:axn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AX27061_5614
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX27061_5614
  Energy metabolism
   00680 Methane metabolism
    AX27061_5614
Enzymes [BR:axn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AX27061_5614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6189485..6192331
Genome map
AA seq 948 aa AA seqDB search
MNASRPQSDSAEPLRHDIRLLGRLLGEVIAECEGKRVFDTIETLRRTAVKFRREGNAADG
KLLEQRVKHLQGSDPNSVARAFSYFLHLSNIAEDRDQNRSQRARALAGDAPARGSLHDAV
QTLGRQGVTPARIRRLLAEACVMPVLTAHPTEVQRKSTLDVHREIAAALTQRDQPLTPEE
LAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRVYGDLSKLLNR
DAKPFGAPPAPLEPFLRMGSWIGGDRDGNPNVDADTLERALLRQATVLFEHYLQEVHALG
AELSITTLLIAVDPALLALAEHSGDDSPHRSDEPYRRALVGVYARLAATALRLTGQNLAR
RSTVAAQPYDTPQELSADLAIIAASLAAHHGAPIGRLRLAGLQQAVEVFGFHLATVDLRQ
SSDVHERALAELFSRAGVTHAGQPLDYLALDEDARVALLRAELAQARPLASPWIAYSEDT
TRELAVLRAAAAGRQRYGRQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIPPED
GLMVVPLFETIPDLQRGADIMAAWLDLPEIRERVKRAQNGAQEVMLGYSDSNKDGGFLTS
NWSLYQAERALVDVFSSRHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTEQ
GEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAQHGPAMSFMSETAQR
SYRGLVYDTPRFAEYFFAATPIAEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCRL
MLTGWYGMGSAIEAYLETGAPGAPRSQRGRLAQLREMARDWPAFRTLLSNMEMVLAKSDL
AIAARYAQLVPQRALREKIFGMISAEHARTLAMLKLLTRRELLADNPALQASLRERFAYI
DPLNYLQVDLIRRHRAAQKSPAAEADERVQRAIHLTINGIAAGLRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccagccgcccgcagtccgattcagcagaacccttgcgtcacgatatccggctg
ttaggccgattgctcggcgaagtcatcgccgaatgcgaaggcaaacgcgtcttcgacacc
atcgagaccctgcgccgcaccgccgtcaaattccgccgcgaaggcaatgccgccgacggc
aagctgctggaacagcgcgtcaagcacctgcagggcagcgaccccaactcggtggcgcgc
gccttcagctatttcctgcacctgtccaacatcgccgaggaccgcgaccagaaccgcagc
cagcgcgcccgcgcgctggcgggcgacgcgccggcccgcggcagcctgcacgatgccgtg
cagaccctgggccgccagggcgtgacgcccgcgcgcatccgccgcctgctggccgaggcc
tgcgtcatgccggtgctgaccgcccaccccaccgaggtgcagcgcaagagcacgctggac
gtgcatcgcgagatcgccgcggcattgacccagcgcgaccaacccctgactcccgaggaa
ctggccgagctcgacgccgcgctgctcggccgcgtggccacgctgtggcagacgcgcatg
ctgcgctacacccgcctgacggtggccgacgaaatcgagaacgcgctgtcgtactaccgc
agcaccttcctgcaggtcatcccgcgcgtctacggcgacctgtccaagctgctcaaccgc
gacgccaagcccttcggcgccccgcccgcgccgctggagccgttcctgcgcatgggcagc
tggatcggcggcgaccgcgacggcaaccccaacgtcgacgccgacacgctggagcgcgcc
ctgctgcgccaggccacggtgctgttcgagcactatctgcaggaagtccacgcgctgggc
gccgaactgtccatcaccacgctgctgatcgcggtcgacccggcgctgctggcgctggcc
gaacacagcggcgacgactcgccgcatcgcagcgacgagccctaccgccgcgcgctggtc
ggcgtctatgcgcgcctggccgccaccgcgctgcgcctgaccggccagaacctggcccgc
cgcagcaccgtcgcggcgcaaccctacgacacgccgcaggaattgtcggccgacttggcc
atcatcgccgcgtcgctggccgcgcatcatggcgcgcccatcggccggctgcggctggcc
ggcttgcagcaggcggtcgaagtgttcggtttccacctcgccacggtcgacctgcgccag
agttccgacgtgcacgagcgcgcgctggccgaattgttcagccgcgccggcgtcacgcac
gcgggccagccgctggactatctggcgctggacgaggacgcgcgcgtggccctgctgcgc
gccgaactggcgcaggcgcggccgctggcctcgccctggatcgcctacagcgaggacacc
acgcgcgaactcgcggtgctgcgcgccgccgccgccggccgccagcgctatggcaggcag
gccgtgcgccagaccatcgtctcgcacaccgaaaccctcagcgacctgctggaagtgatg
gtgctgcagaaggaagcgggcctgatcgcgcccgccggccaggacatcccgccggaagac
ggcctgatggtggtgccgctgttcgagaccattcccgacttgcagcgcggcgccgacatc
atggccgcctggctcgacctgcccgagatccgcgagcgcgtgaagcgcgcccagaacggc
gcccaggaagtcatgctgggttattccgacagcaacaaggacggcggtttcctcacctcc
aactggtcgctgtaccaggccgagcgcgcactggtcgacgtgttctccagccgccacgtg
cgcctgcgcctgttccatggacgcggcggctcggtgggccggggcggcggctccagcttc
gacgccatcctggcgcagccgccgggcacggtggccggccagatccgcctgaccgaacag
ggcgaggtcatccagagcaagtacaaggacgccgaggtcggccgctggcacctggagctg
ctggtcgccgccacgctcgaatccagcctggcgccgcgcgccgaggccaccagcgcggaa
gacgcgcacatggcgcagcacggcccggccatgtcgttcatgtccgagaccgcgcagcgc
agctaccgcggcctggtgtatgacacgccgcgctttgccgagtacttcttcgccgccacg
cccatcgccgagatcgccggcctgaacatcggctcgcgcccggcctcgcgcaagaagggc
cagcgcatcgaagacctgcgcgccatcccctgggggttttcctgggcccaatgccgcctg
atgctgaccggctggtacggcatgggctcggccatcgaggcctatctggagaccggcgcg
ccgggggcgccgcgctcgcagcgcggccgcctggcccagttgcgcgaaatggcgcgcgac
tggcccgccttccgcaccctgctgtccaacatggagatggtgctggccaagtccgacctg
gccatcgccgcgcgctatgcgcagttggtgccgcagcgcgcgctgcgcgagaagatcttc
ggcatgatcagcgccgaacacgcccgcaccctggccatgctcaagctgctgacgcggcgc
gagctgctggccgacaaccccgcgctgcaggcctcgctgcgcgagcgcttcgcctacatc
gacccgctcaactacctgcaggtcgacctgatccgccgccaccgcgcggcgcagaagtcg
cccgccgccgaggccgacgaacgcgtgcaacgcgccatccacctgaccatcaacggcatc
gccgccgggttgcgcaattcgggctga

DBGET integrated database retrieval system