KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_010151Help
Entry
NH44784_010151    CDS       T02785                                 

Definition
Threonine dehydrogenase and related Zn-dependent dehydrogenases
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:axo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH44784_010151
  Energy metabolism
   00680 Methane metabolism
    NH44784_010151
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NH44784_010151
Enzymes [BR:axo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     NH44784_010151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1069763..1070929)
Genome map
AA seq 388 aa AA seqDB search
MKVNTFKFPELITPQGKSAPHGAILKIVTTNICGSDLHIYRGSFAVPKGMTMGHEMTGEV
IEVGSDVEVVKKGDIVSVPFNVGCGRCYNCKHMRSDVCENTNPEIDCGAYGFNLGGWTGG
QGDYLFVPYADFNLLRFPDKDAAMEKIRDLTLLSDVLPTAFHGFAGPDWPAAPAYVVGEN
ILIFGAGPVGRAGAACARLLGAGAIIVADYIQERLDLLKPHGVETINLSDGVPIEEHLER
ITGHREVDRVIDYVGVDCRGFGAEADKIVESAVTNAMLKYVRFGGMTSTVGVYCANPISK
DPKAKKGHMDLEWSNAWIKSPRMSAGQSPTANYNHALMRAILNDRMPYLSPMMNTKFIKL
EDAPAAYKEFDAGSAYKYVIDPHGSVRH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaacaccttcaaatttccagagctgataacccctcaagggaaaagcgcaccc
catggcgctatcctcaaaatagttaccacaaatatctgtggcagcgaccttcacatttat
cgcggttcgtttgctgttcccaagggaatgaccatgggccatgaaatgaccggcgaagtg
atcgaagtgggatcagacgtcgaagtcgtgaagaagggcgacatcgtttccgttcccttc
aatgtggggtgtgggcgttgctacaactgcaagcatatgcgctccgatgtatgcgagaac
accaaccccgaaatcgactgcggagcctacgggttcaacctcggtggctggacggggggg
caaggtgattatctcttcgtaccgtatgcggatttcaatctccttcgcttccctgacaag
gatgccgccatggaaaaaatccgcgacctgacccttctctctgacgtattacccacagct
ttccatgggttcgctggcccagactggccagccgcgccggcctacgtcgtcggcgaaaac
atcctgatcttcggtgccgggccggtcggcagagcgggtgccgcctgcgccagacttctg
ggtgcaggcgccatcatcgttgccgattacattcaagagcggctggaccttctcaagcca
cacggcgtggaaaccatcaacctttccgacggcgtgccgatcgaggagcatctcgaacgc
attaccgggcacagggaggtggatcgcgtcatcgactatgttggtgtggactgccgcggg
tttggcgcggaggctgacaagatcgtggagagcgctgttaccaacgcaatgctcaaatat
gtccgcttcggcggaatgaccagtacggtcggtgtgtactgcgcaaacccgatctcgaaa
gacccgaaagccaagaaaggccatatggatctggaatggtccaacgcctggatcaagtcg
ccgcgaatgtcggctggtcaatctccgacggccaactacaaccacgcgttaatgcgggcg
atactgaacgatcgcatgccttacctttcgccgatgatgaacactaagttcatcaagctc
gaagacgcgcccgccgcgtacaaagagttcgacgcgggttctgcatacaagtacgtcatc
gacccgcatggttcagtgcggcattaa

DBGET integrated database retrieval system