KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_012981Help
Entry
NH44784_012981    CDS       T02785                                 

Definition
Esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Brite
Enzymes [BR:axo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     NH44784_012981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1379074..1379937)
Genome map
AA seq 287 aa AA seqDB search
MTTPRTGALLIHGLGGTEFDMGSLHKVLARAGVETHGVTLPGHAGRPEDLLDVRVEDWMD
VVTRRYRELCEQYEVVHVIGMCLGALLAVELCKRESHTRGALVSLSAPVFLDGWSTPWYR
GLRYLLYHVPGVPRRIRVEEEDPYGVKSELVRAFIKAGFARGDGFHYQWVPLACVRQVDR
LRGMVKRGLEQMRCPTLVMHAVEDELTSPRSARLLGARIPGASVVLLQDSYHMICVDHER
ERVMQNVLAFLGKDPGIVRVRRRAAESRRTRGATAPDEAQGLLVAAR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgcctcgcaccggagcgctgctgatccatggcctgggcggcaccgaattcgac
atgggctcgctgcacaaagtgctggcgcgcgcgggagtggaaacccatggcgtgacgttg
cccggccacgccggccggcccgaggacctgctggacgtgcgggtcgaggactggatggac
gtggtgacgcgccgctaccgcgagttgtgcgagcagtacgaagtcgtgcacgtcatcggc
atgtgcctgggcgcgctgctggccgtggaactgtgcaaacgcgaatcgcatacccgaggc
gcgctggtgtcgctgtccgcgcccgtgttcctggatggctggagcacgccgtggtatcgc
ggcctgcgctacctgctttaccacgtgccgggggtgccgcgccgcatccgggtcgaggaa
gaagacccctacggcgtcaagagcgaattggtgcgggccttcatcaaggccggtttcgcg
cggggcgacggcttccattaccaatgggtgccgctggcctgcgtgcgccaggtcgaccgg
ctgcgcggcatggtcaagcgcgggctggagcagatgcgctgcccgacgctggtgatgcac
gcggtcgaggacgagctgaccagtccgcgctcggcgcgcctgctgggcgcgcggattccc
ggcgcgtcggtggtgttgctgcaggacagttaccacatgatctgcgtggatcacgagcgc
gagcgcgtgatgcagaacgtgctggcattcctgggcaaggatccgggcatcgtgcgtgtg
cggcggcgcgccgcagaatcgcggcggacccgcggcgcaaccgcgccggacgaggcgcaa
ggcctgctggtggccgcccgctag

DBGET integrated database retrieval system