KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_018191Help
Entry
NH44784_018191    CDS       T02785                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Brite
Enzymes [BR:axo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NH44784_018191
Secretion system [BR:axo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NH44784_018191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1927494..1928297)
Genome map
AA seq 267 aa AA seqDB search
MNFRFSATLAACFMAAGLGLSASAQAQATGDKAVSTSTVGQAGKGSKSYSTTQVAPADPV
ADAVKERFRQRFTGMDVTAVRRTPYGLFEVQLGMDLIYTDEKVTWVMEGPLIDAMTRRDV
TREAQEKLGSIPFDQLPLDLAIKQVKGDGSRKVAIFEDPNCGYCKQLRKTLEDVDNITVY
TFLYPILSPDSNVKVRDVWCSADPGKAWDDWMLRGQKPATANCSVPEDKLLALGKQLMVR
GTPTMFFADGSRTSGALPLDQLKARLN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccgtttttccgccacgctggccgcctgcttcatggccgcgggcctgggcctg
tccgccagcgctcaagcgcaggcaacgggcgacaaggccgtttccaccagcacggtcggc
caggcgggcaagggcagcaagagctattccaccacccaggtggcgcccgccgatcccgtg
gcggatgcggtcaaggaacgtttcaggcagcgcttcaccggcatggacgtgaccgccgtg
cgccgcacgccctacgggctgttcgaggtgcaattgggcatggacctgatctacaccgat
gaaaaagtgacctgggtgatggaaggtccgctgatcgacgccatgacgcgccgcgacgtc
acccgcgaggcgcaggaaaagctcggttccatcccgttcgaccagttgccgctggacctg
gccatcaagcaggtcaagggcgacggctcgcgcaaggtcgcgatcttcgaggaccccaac
tgcggttactgcaagcagttgcgcaagacgctcgaagacgtcgacaacatcaccgtctac
accttcctgtacccgatcctgtcgcccgactccaacgtcaaggtgcgtgacgtctggtgc
tcggcggacccgggcaaggcgtgggacgactggatgctgcgcggccagaagccggccacc
gccaattgcagcgtgcccgaggacaagttgctggcgctgggcaagcaactgatggtgcgc
ggcacgcccacgatgttctttgccgacggctcgcgcaccagcggcgcgttgccgctggac
caactcaaggcacgactgaactga

DBGET integrated database retrieval system