KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_022111Help
Entry
NH44784_022111    CDS       T02785                                 

Definition
Catalase (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NH44784_022111
  Amino acid metabolism
   00380 Tryptophan metabolism
    NH44784_022111
Enzymes [BR:axo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     NH44784_022111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2361391..2362836
Genome map
AA seq 481 aa AA seqDB search
MTDKKHLTTASGAPVADNNNTLTAGPRGPALLQDFWLIEKLAHFDRERIPERVVHAKGSG
AYGTFTVTHDITKYTRASIFSKVGKQTPLFLRFSTVAGERGAADAERDVRGFAIKFYTDE
GNWDLVGNNTPVFFIRDPLKFPDFIHTQKRDPKTNLRSATAAWDFWSLSPESLHQVTILM
SDRGIPANLRQQHGFGSHTFSFVNAEGERFYVKFHFKSQQGIACLTDEEAAQVVAHDRES
SQRDLFDNIEQGNFPKWTLKVQIMPAAEAETYHINPFDLTKVWPHGDYPLIEVGVLELNK
NPENYFAEVEQAAFTPANVVPGIDFSPDKMLQGRLFSYGDTHRYRLGINHHQIPVNAPRC
PFHSYHRDGAARVDGNAGGTLNYEPNSAGEWKETPSAGEPPLPLDGQAAARWNHRVDDDY
YSQPGALFRLMTPAQQELLFGNIGRHMAGVPEEIQRRQLEHFRKADPAYAAGVAKALGLK
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagaagcatctgaccaccgcctctggcgccccggtggccgacaacaacaac
accctgaccgccggcccgcgcggcccggcgttgttgcaggacttctggctgatagaaaag
cttgcccatttcgaccgtgaacgcatccccgaacgcgtggtgcacgccaagggctcgggc
gcctatggcaccttcaccgtcacccacgacatcaccaagtacacccgcgccagcatcttc
tccaaggtcggcaagcagacgccgctgttcctgcgcttctcgaccgtggccggcgagcgc
ggcgcggccgacgccgagcgcgacgtgcgcggcttcgccatcaagttctacaccgacgaa
ggcaactgggacctggtcggcaacaacaccccggtgttcttcatccgcgacccgctcaag
ttccccgacttcatccacacccagaagcgcgaccccaagaccaacctgcgcagcgccacg
gcggcctgggatttctggtcgctcagccccgaatcgctgcaccaggtcaccatcctgatg
agcgaccgcggcattccggccaacctgcgccagcagcatggcttcggctcgcacaccttc
agcttcgtcaatgccgaaggcgaacgcttctacgtgaagttccacttcaagtcgcagcag
ggcattgcctgtctgacggacgaggaagccgcgcaggtcgtggcgcacgaccgcgaaagc
tcgcaacgcgacctgttcgacaacatcgagcagggcaacttcccgaagtggacgctgaag
gtgcagatcatgcccgcggccgaagccgagacctatcacatcaatccgttcgacctgacc
aaggtgtggccgcacggcgattacccgctgatcgaagtgggcgtgctggaactgaacaag
aacccggaaaactacttcgccgaggtcgagcaggccgccttcacgcccgccaacgtggtg
cccggcatcgacttctcgccggacaagatgctgcagggccgcctgttctcgtacggcgac
acgcaccgctaccgcctgggcatcaaccaccaccagatcccggtgaacgcgccgcgctgc
ccgttccacagctatcaccgcgacggcgcggcgcgcgtggatggcaatgccggcggcacg
ctcaactacgagcccaacagcgccggcgaatggaaggaaaccccgtcggccggcgagccg
ccgctaccgctggacggccaggccgccgcgcgctggaaccaccgcgtcgatgacgactac
tactcgcagccgggcgccttgttccgcctgatgacgccggcgcagcaggagttgctgttc
ggcaacatcggccgccacatggccggcgtgcccgaggaaatccagcgccgtcagctggaa
cacttccgcaaggccgatccggcctacgcggcgggcgtggccaaggcactgggcctgaag
ctgtaa

DBGET integrated database retrieval system