KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_030791Help
Entry
NH44784_030791    CDS       T02785                                 

Definition
Fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:axo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NH44784_030791
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NH44784_030791
Enzymes [BR:axo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NH44784_030791
Lipid biosynthesis proteins [BR:axo01004]
 Desaturase
  First
   NH44784_030791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3306965..3307894)
Genome map
AA seq 309 aa AA seqDB search
MRPEPSHWTTSIRRWVDTQAAGAPAGPPDRIDWTRALPFALLHVGCLGVAWTGVSPAAVA
VAVALYAVRMFALTGFYHRYFSHRTFRTSRAMQLVFAILGASCAQRGPLWWAAHHRHHHR
HADDEQDLHSPARHGFWWSHMGWFLTPRAFATDLARVPDLRGYRELRWLDRFDAAVPIAL
ALLCYALGAALERLAPGLGTSGPQMLVWGFFISTVALFHATVTINSLAHRYGKRRYDTAD
DSRNNAWLALLTFGEGWHNNHHFYPGSARQGFRAREIDLTWYGLRLLATTGLIWDLKPVP
AWVLARAKE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctgaaccctctcactggaccacttcgatacgccgctgggtcgatacccaggcg
gcgggcgcgcccgccggcccgcccgaccgcatcgactggacccgcgccctgcccttcgcg
ctgctgcacgttggctgcctgggcgtcgcatggaccggcgtctcgccggcggcggtggcc
gtggcggtggcgctctacgccgtgcgcatgttcgccctgaccggcttctaccaccgctat
ttctcgcaccgcaccttccgcacctcgcgcgccatgcagctggtgttcgccattctcggc
gcttcgtgcgcccagcgcggcccgttatggtgggcggcgcaccaccgccaccatcaccgc
cacgccgacgacgaacaggatctgcactcgccggcccgccacggtttctggtggagccac
atgggctggttcctgacgccgcgcgccttcgccaccgacctggcgcgcgtgccggatctg
cgcggctaccgcgaactacgctggctggaccgcttcgacgccgccgtgcccatcgcgctg
gcgctgctgtgctatgccctgggcgccgcgctcgagcgcctggcgcccggcctgggcacc
agcgggccgcagatgctggtgtggggcttcttcatctcgacggtggcgctgttccatgcg
accgtcaccatcaattcactggcgcaccgctacggcaagcgccgctacgacaccgccgac
gatagccgcaacaacgcctggctggcgcttttgaccttcggcgaaggctggcacaacaac
caccacttctatcccggttcggcgcgccagggctttcgcgcccgggaaatcgacctcacc
tggtacggcctgcgcctgctggcgaccaccggcctgatctgggacctgaaacccgtgccg
gcctgggtgctggcgcgcgccaaggaatga

DBGET integrated database retrieval system