KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_043691Help
Entry
NH44784_043691    CDS       T02785                                 

Definition
NAD-specific glutamate dehydrogenase (EC:1.4.1.2 1.4.1.4)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axo00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NH44784_043691
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NH44784_043691
   00330 Arginine and proline metabolism
    NH44784_043691
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NH44784_043691
Enzymes [BR:axo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     NH44784_043691
Exosome [BR:axo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NH44784_043691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4659152..4660558
Genome map
AA seq 468 aa AA seqDB search
MTLTVFISILRPQLIFFHKIWGHNKDMDKMAQLCQESMFMSQTPTHALPSYLNADELGPW
GNYLQQVDRVTPYLGSLARWVETLKRPKRSLIVDVPIELDNGSVAHFEGYRVQHNTSRGP
GKGGVRFHQDVTLSEVMALAAWMSVKNAAVNLPYGGAKGGIRVDPRKLSQSEIERMTRRY
TSEIGVIIGPSKDIPAPDVNTNAQTMAWMMDTYSMNEGSTATGVVTGKPIALGGSLGRVE
ATGRGVFVVGCEAARDLNIDVSKARVVVQGFGNVGGTAARLFHEAGAKVIAAQDHTGTVH
NAAGLDVHKLLSHVSQHGGVGGFSGGQAMDKNEFWTLETEFLIPAALESQITADNAAKVR
AKIVVEGANGPTTPEADDILFEHGVYVVPDVLANAGGVTVSYFEWVQDFSSFFWSEDEIN
QRLERIMREAYASIALVAKEHKVTLRTAAFIVACTRILQARQVRGLYP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcacggtcttcatttccatattgcgtccccaattaatatttttccataaaata
tggggacacaataaggatatggataaaatggcgcaactttgtcaggagagcatgttcatg
tctcaaactcccacccatgccttgccgtcttatctgaatgccgacgaactcggcccctgg
ggtaattacctgcaacaagtcgaccgggtcacgccgtacctcggttcgctggcgcgctgg
gtcgagaccctgaagcgtccgaagcgctcgctgatcgtcgatgtgccgatcgagctggac
aatggcagcgtggcccacttcgagggttatcgcgtgcagcacaacacctcgcgcggtccg
ggcaagggcggcgtgcgtttccaccaggacgtgacgctgtcggaagtgatggcgctggcc
gcctggatgtcggtcaagaacgccgcggtcaacctgccgtacggcggcgccaagggcggc
atccgcgtcgatccgcgcaagctgtcgcagtccgagatcgagcgcatgacgcgccgctac
acctcggaaatcggcgtcatcatcggcccgtccaaggacattcccgcccctgacgtgaac
accaacgcccagaccatggcctggatgatggacacgtactccatgaacgaaggctcgacc
gccaccggcgtcgtgaccggcaagccgatcgcgctgggcggcagcctgggccgcgtcgag
gccaccggccgcggcgtgttcgtggtcggctgcgaagccgcgcgcgacctgaacatcgac
gtgtccaaggcgcgcgtggtggtgcagggcttcggcaacgtgggtggcactgccgcccgc
ctgttccatgaagccggcgccaaggtcatcgcggcgcaggaccacaccggcacggtgcac
aacgccgccggcctggacgtccacaaactgctgtcgcacgtgtcgcagcatggcggcgtg
ggcggcttctccggcggccaggcgatggacaagaacgagttctggacgctcgaaaccgaa
ttcctgatcccggcggccctggaaagccagatcaccgccgacaacgccgccaaggtgcgc
gccaagatcgtggtggaaggcgccaacggcccgaccaccccggaagcggacgacatcctg
ttcgagcacggcgtgtacgtggtgccggacgtgctggccaacgccggcggcgtgacggtg
tcgtacttcgaatgggtgcaggacttctccagcttcttctggagcgaggacgaaatcaac
cagcgcctggaacgcatcatgcgcgaggcctatgcctcgatcgcgctggtggccaaggag
cacaaggtgacgctgcgcaccgccgcgttcatcgtggcttgcacgcgcatcctgcaggcc
cgccaggtgcgcggcctgtacccgtaa

DBGET integrated database retrieval system