KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_055841Help
Entry
NH44784_055841    CDS       T02785                                 

Definition
Fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:axo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:axo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5989727..5990935)
Genome map
AA seq 402 aa AA seqDB search
MDYILSFIAGGLTQATWWQIVVFTLVMTHITIVSVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPILFGIWKVLFRGAELYREESNNKETMA
KFGHGTPDDWLERNVYSKHSLWGVLTMLAIDIALFGAIGVTVWAVQMAWIPFWAAGVVNG
IGHYWGYRNYNSPDTSTNVFPWGIVIGGEELHNNHHAHGTSAKFSAKWYEFDIGWCYINI
LKFLGLAKIKKVAPKLKLDDSKTGIDLRTLQGVITHRYEVMARYADVIKSAAREELAKLK
ASRQDGNAECGWNKLHKVRRAIHRNEDILQPEQLEAVDKAIAQNKSLSTLVQMRRELGRI
WESSSASSEQLLHDLQAWCQRAQQSGIAGLEQFAQRLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattacatcctctccttcattgccggcggtttgacccaagccacttggtggcagatc
gtcgttttcaccctggtcatgacgcacatcaccattgtgtccgtcaccgtcttcctgcac
cgcagccaggcgcaccggggcctggatctgcatccggccgtcatgcacttcttccgcttc
tggctctggatgacgaccggcatggtcaccaaggaatgggttgccatccaccgcaagcat
cacgccaagtgcgaaaaggaaggcgatccccattcgcccatcctgttcggcatctggaag
gtgctgttccgcggcgccgagctctaccgcgaagaatccaacaacaaggaaaccatggcc
aagttcggccacggcacgcctgacgactggctcgaacgcaacgtctacagcaagcacagc
ctgtggggcgtgctgaccatgctcgccatcgacatcgccctgttcggcgcgatcggcgtc
acggtgtgggcggtgcagatggcctggattcccttctgggcggccggcgtcgtcaacggc
atcggccactactggggctatcgcaactacaacagcccggacaccagcaccaacgtgttc
ccgtggggcatcgtgatcggcggcgaagagctgcacaacaaccaccacgcccacggcacg
tcggccaagttctcggccaagtggtacgagttcgacatcggctggtgctacatcaacatc
ctgaagttcctgggcctggccaagatcaagaaggtcgcgcccaagctcaagctggatgac
tccaagaccggcatcgacctgcgcacgctgcaaggcgtgatcacgcaccgctacgaagtc
atggcccgctacgcggacgtgatcaagagcgccgcccgcgaggaactggccaagctgaag
gcctcgcgccaggacggcaacgccgaatgcggctggaacaagctgcacaaggtgcgccgc
gccatccaccgcaacgaggacatcctgcaaccggagcaactcgaagccgtggacaaggcc
atcgcccagaacaagtcgctgtcgacgctggtgcagatgcgccgcgaactcggccgcatc
tgggaaagctccagcgccagcagcgaacagcttctccatgacctgcaggcctggtgccag
cgcgcccagcaaagcggcatcgccgggctcgagcaattcgctcaacgtctgcgccgctac
gcggcatga

DBGET integrated database retrieval system