KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_058581Help
Entry
NH44784_058581    CDS       T02785                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:axo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NH44784_058581
Enzymes [BR:axo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     NH44784_058581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6299751..6300536)
Genome map
AA seq 261 aa AA seqDB search
MADTMHLGKDELIARAKAEMQRQFDTPDWTLRERLALTCRILFDGGHDSGLAGQITARAP
EPNRYYTQRLGLGFDEITAGNLLLVDEDLRVQEGGGMPNPANRFHSWIYRARPDVNCIIH
THPLHAASLSMLEVPLEVSHMDNCPLYGDVAFLKDWPGVPVGNEEGEIISAALGDKRAIL
LSHHGMLVAAGTVEEACVLALQFERAARMQLLAMAAGTIQPIPPALGREAHDWILTPKRS
QVGFSYYARRALRQHPDVLGA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgatgcatttgggcaaggatgaactgatcgcgcgggccaaggccgagatg
cagcgccagttcgacacgcccgactggacgctgcgcgagcgcctggcgctgacctgccgc
atcctgttcgacggcgggcacgattcgggcctggccggccagatcacggcgcgcgcgccg
gaacccaaccgctactacacccagcggctgggcctgggcttcgacgagatcacagccggc
aacctgctgctggtggacgaggacctgcgggtgcaggaaggcggcggcatgcccaacccg
gccaaccgtttccattcctggatctaccgggcgcggccggacgtcaactgcatcatccac
acgcacccgctgcacgcggcctcgctgtcgatgctggaggtgccgctggaggtctcgcac
atggacaactgcccgctgtatggcgacgtggcgttcctgaaggactggccgggcgtgccg
gtgggcaacgaggaaggcgagatcatctcggcggcgctgggcgacaagcgcgccatcctg
ctgtcgcaccacggcatgctggtggccgcgggcacggtggaagaggcctgcgtgctggcg
ctgcagttcgagcgcgccgcgcgcatgcagctgctggcgatggcggccggcacgatccag
ccgattccgccggcgctggggcgcgaggcgcacgactggatcctgacgcccaagcgctcg
caggtgggtttttcgtactacgcgcggcgggcgttgcgccagcacccggacgtgctgggc
gcgtag

DBGET integrated database retrieval system