KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_059781Help
Entry
NH44784_059781    CDS       T02785                                 

Definition
Trehalose synthase (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:axo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6419752..6423066
Genome map
AA seq 1104 aa AA seqDB search
MVYQLHVKSFFDSNDDGVGDLPGLISKLDYIANLGVDTIWLLPFYPSPRRDDGYDIADYR
GVHPDYGTVADVRKLIRAAHARGLRVITELVVNHTSDQHPWFQRARTSRPGSAARNFYVW
SDNDKAYAGTRVIFCDTEKSNWTWDPVANAYFWHRFYSHQPDLNYDNPQVLKEVLAVMRH
WLDMGVDGLRLDAVPYLVEREGTNNENLPETHQVLKRIRAVIDSEYPGRLLLAEANQWPE
DAQEYFGNGDECHMSFHFPLMPRMYMAIAQEDRFPITDIIRQTPDIPATCQWAIFLRNHD
ELTLEMVTSRERDYLWSVYAADPRARINLGIRRRLAPLLERDRRRVELMNSLLLSMPGTP
VLYYGDELGMGDNVHLGDRDGVRTPMQWSPDRNGGFSRADPERLPLPVLMGPLYGYEAVN
VEAQQRDPHSLLNWTRRMLAQRRQTHAFGRGTLRFIQAGNRKILAYLRQWRDTTILCVAN
LSNAAQPVELPLQAFNGRVPVEMLGGTPFPAIGELPYLLTLPPYGFYWMDLSAEAAPPGW
HASAPERMPELVTLVLRGHANAVLTDGSRQTLETEVLPEYLARQRWFPGATPPARASLAY
ATPFGAGRAESSGAGTTEYYWAEAEPADAAVARRVQIPFALVWDEAAQVQYPIARVRRGP
EVGILADAFLQPGFVLGVVDALRHGREWDGRQGGKPGERPGVIRSLPEPGMTELALDAEP
ALQWISGEQSNSSVVIGGKAILKLLRNAPPGLSAEVEMSRHLTRAGYANIPALLGEIQRV
DGDGVPCTLAVLYAYIANEGDAWNWTLDYLKRTLATALLGGDSPEEFEASLEGYATQAAT
IGRRLAQLHQVLARPSDDPAFAPAIASQEEADALAARVVGQLDQAAQALRACVDSLEEPS
RACAQWLFDHHGRLVARIERMAQALAGSPLIRVHGDLHLGQVLVAQTDAYLIDFEGEPDQ
PLSLRRQLASPAKDVAGMLRSFDYAAAAVARHDPLGGAPTDANAAPMENAATANSPAQLR
DALLARFRARATEAFLQGYEEAGAAPSPAWRTLLQLAQLEKAAYEIGYEAGHRPDWISIP
LCALSGLAHALVQNAAIDAEDPTP
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
gtggtctaccaactgcatgtgaagtcgttcttcgattccaacgacgacggcgtgggcgac
ctgcccgggctgatttccaagctcgactacatcgccaacctgggcgtcgatacgatctgg
ctgctgcccttctacccctcgccgcgacgcgacgacggctacgacatcgccgactaccgc
ggcgtgcacccggactacggcacggtcgccgacgtgcgcaagctgatccgagcggcccac
gcgcgcggcctgcgcgtcatcaccgagctggtggtcaaccatacctccgaccagcatccg
tggttccagcgggcgcgcacctcgcggcccggctcggcggcgcgcaatttctacgtatgg
tcggacaacgacaaggcctacgccggcacccgcgtgatcttctgcgacaccgagaagtcc
aactggacctgggacccggtggccaacgcctacttctggcaccgcttctactcgcaccag
cccgacctgaactacgacaacccgcaggtgctcaaggaagtgctggcggtgatgcgccac
tggctggacatgggcgtggacggcctgcggctggacgccgtgccctacctggtcgagcgc
gagggcaccaacaacgagaacctgcccgagacccaccaggtgctcaagcgcatccgcgcc
gtcatcgacagcgagtatccgggccgcctgctgctggccgaggccaaccagtggcccgag
gacgcgcaggagtatttcggcaatggcgacgaatgccacatgtcgttccacttcccgctg
atgccgcgcatgtacatggcgatcgcgcaggaagaccgctttcccatcaccgacatcatc
cggcagacgcccgacatccccgccacctgccagtgggccatcttcctgcgcaaccacgac
gaactgacgctggagatggtcaccagccgcgaacgcgactacctctggagcgtctacgcg
gccgatccgcgcgcccgcatcaacctgggcatccgccgccgcctggcgccgctgctggaa
cgcgaccggcggcgggtcgaactgatgaacagcctgctcttgtcgatgcccggcacgccg
gtgctgtactacggcgacgaactgggcatgggcgacaacgtgcacctgggggaccgcgac
ggcgtgcgcacgccgatgcaatggtcgcccgaccgcaacggcggcttctcgcgcgccgac
cccgaacggctgccgctgccggtgttgatggggccgctgtatggctatgaggccgtcaac
gtcgaggcccagcagcgcgacccgcactcgctgctgaactggacccgccgcatgctggcg
cagcgccgccagacccacgccttcggccgcggcacgctgcgcttcatccaggccggcaat
cgcaagatcctggcctacctgcggcaatggcgcgacaccaccatcctgtgcgtggccaac
ctgtccaacgccgcccagccggtcgaactgccgctgcaggccttcaacggccgcgtgccg
gtggagatgctgggcggcacgccgtttcccgcgatcggcgagctgccctacctgctgacg
ctgccgccctatggcttttactggatggacctgagcgccgaggcggctccgcccggctgg
cacgcgagcgcgccggaacgcatgccggagctggtcacgctggtgttgcgcggccatgcc
aacgccgtcctcacggatggctcgcgccagaccctggaaaccgaagtgctgccagaatac
ctggcgcgccagcgctggttccccggcgccacgccgcccgcccgggcgtcgctggcctac
gccacgcccttcggcgccggccgggccgaatcctccggcgccggcactaccgaatactac
tgggccgaagccgagccagccgacgccgcggtcgcgcggcgggtgcagatcccgttcgcg
ctggtctgggacgaggccgcgcaagtgcagtacccgatcgcgcgcgtgcggcgcggccct
gaagtcggcatcctggccgatgccttcctgcagcccggcttcgtgctgggggtggtcgac
gccctgcgccacggccgcgaatgggatggccggcaaggcggcaagccgggcgagcggccc
ggcgtgatccgcagcctgcccgaacccggcatgacggaactggcgctggacgccgaaccg
gcgctgcaatggatcagcggcgagcagtccaacagttcggtggtgatcggcggcaaggcc
atcctgaaactgctgcgcaatgccccgccggggctgtcggcggaagtcgagatgagccgc
cacctgacccgcgcgggctatgccaacatccccgcgctgctgggcgaaatacaacgcgtg
gacggcgatggcgtgccctgcacgctggcagtgctgtacgcctacatcgccaacgaaggc
gacgcctggaactggacgctggactacctgaagcgcacgctcgccacggcgctgctgggc
ggcgacagccccgaggaattcgaagccagcctggaaggctatgccacccaggccgccacc
atcggccggcgcctggcgcaattgcaccaggtgctggcgcggcctagcgacgatccggcg
ttcgccccggccatcgcgtcgcaggaagaggccgatgccctcgccgcgcgcgtcgtgggc
cagctcgatcaggccgcccaggcgctgcgcgcctgtgtcgacagcctggaggaaccttcg
cgggcctgcgcccaatggctgttcgaccaccacggccgcctggtggcgcggatcgagcgc
atggcgcaagccctcgccggcagcccgctgatccgcgtccatggcgatctgcatctgggc
caggtgctggtggcgcagaccgatgcctacctgatcgacttcgagggcgaacccgaccag
ccgctgtccctgcgccggcaactggcctcgcccgccaaggacgtggccggcatgctgcgg
tcgttcgactacgcggccgccgccgtggcgcgccacgatccgctgggcggcgcccccacc
gacgccaacgcggcgccgatggaaaacgccgccaccgcgaattcgccggcgcagctgcgc
gatgcgttgctggcgcgctttcgcgcccgcgccaccgaggccttcctgcaaggctacgag
gaagccggagccgcgccgtcgccggcctggcgcaccctgctgcaactggcccaactggaa
aaagccgcctacgagatcggctacgaggccggccaccgccccgactggatctccattccg
ctgtgcgcgctgtccggcctggcgcatgcgctggtgcagaacgcggcgatcgacgccgag
gacccgacgccatga

DBGET integrated database retrieval system