KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_059791Help
Entry
NH44784_059791    CDS       T02785                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme,GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NH44784_059791
Enzymes [BR:axo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NH44784_059791
Exosome [BR:axo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NH44784_059791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6423063..6425279
Genome map
AA seq 738 aa AA seqDB search
MSRRNHDPRASAASPHPAPAALDAAQRAALLAGAHDDPFAVLGPHDGGVRALLPGARSVT
VVAPDGARFPLTDEGDGLFSGPAGPARAGAGHSYQLDIEWPDARQHVADTYAFGPLLPTE
ALQGLRDGDWRAALAWLGVRPASVDGVDGVRCAVWAPNARRVALVGDFNSWDPRRHGMRL
RHEAGVWELFVPDVAAGARYKFAITDATGAVRFKADPHARRAEPPPATASIVDAAAPYPW
TDDDWMRARGERHAPGAPIAIYEVHAGSWLAPDGGCPWRQLADKLPAYAASMGFSHIELM
PIMEHPFGGSWGYQPLGLFAPSARFGPPAAFAHFVDRCHAAGIGVILDWVPAHFPDDAHG
LARFDGTALYEYDDPREGYHPDWHTLVYNLGRTEVRAFMIASALHWLRRFHVDGLRVDAV
ASMLYRDYSRRPGEWIPNRHGGRENLEAVDFLRGLNQAVRDEVPDAMMIAEESTAWPGVT
APVADGGLGFHYKWNMGWMHDTLRYLAEDPVHRKYHHGELTFSMVYAYAERYVLPLSHDE
VVHGKGSLLNKMPGDVTARFANLRAYLGYMWAHPGKKLLFMGGEIAQAAEWNHDAPLDWN
LLDDPARKGMQRLVGDLNRLYRSQPALHARDADPAGFAWVVLDDADNSVVAFLRTDGAAQ
VLAVSNFTPVARAAYRVGVPLGGRWDEILNTDAGSYGGTGAGNLGRAQARAEPAHGHAQS
LLLTLPPLSTLYFLHRDE
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgcaaccacgacccgcgcgccagcgccgcatccccgcatcccgcgccggcc
gccctggacgcggcgcagcgcgccgcgctgctggccggcgcccatgacgacccgttcgcc
gtgctcgggccgcatgacggcggcgtgcgcgcgctgctgcccggcgcgcgctcggtgacc
gtggtcgcccccgatggcgcccgcttcccgctgacggacgagggcgatggcctgttcagc
gggccggccgggccggcccgggccggcgccgggcattcctaccaactggacatcgaatgg
ccggacgcgcgccagcatgtcgccgacacgtacgcgttcgggccgctgctgcctaccgag
gcgctgcaaggcctgcgcgacggcgactggcgggccgcgctggcgtggcttggcgtgcgg
cccgccagcgtcgacggcgtggacggggtgcgctgcgcggtctgggcgccgaacgcgcgg
cgcgtggcgctggtgggcgacttcaacagctgggatccgcggcgccacggcatgcgcctg
cgccacgaggccggcgtatgggaactgttcgtgccggacgtcgcggccggcgcgcgctac
aaattcgcaatcaccgacgccaccggcgcggtccgcttcaaggccgatccgcacgcccgc
cgcgccgaaccgccgccggccaccgcctcgatcgtggatgcggccgccccctacccctgg
accgacgacgactggatgcgggcgcgcggcgaacgccatgcgcccggcgcccccatcgcc
atctatgaagtccacgcgggctcctggctggcgccggacggcggctgcccgtggcggcaa
ctggccgacaagctgcccgcctatgccgcctcgatgggtttttcgcacattgagttgatg
cccatcatggaacacccgttcggcggatcctggggctatcagccgctggggctgttcgcg
cccagcgcgcgcttcggcccgccggcggcgttcgcgcacttcgtcgaccgctgccacgcg
gccggcatcggcgtgatcctggactgggtgccggcccacttccccgatgacgcgcatggg
ctggcccgttttgacggcaccgcgctctacgagtacgacgacccgcgcgaaggctaccac
cccgactggcacacattggtctacaacctgggccggaccgaagtccgtgccttcatgatc
gccagcgcgctgcactggctgcggcggttccacgtcgacggcctgcgggtggacgcggtg
gcgtcgatgctgtaccgcgactacagccgccgtcccggcgaatggattccgaaccgccac
ggcggccgcgagaacctggaggccgtcgacttcctgcgcggcctcaaccaggccgtgcgc
gacgaggtgcccgacgccatgatgatcgccgaggaatccaccgcctggcccggggtcacc
gcgccggtggcggacggcggcctgggcttccactacaagtggaacatgggctggatgcac
gacacgctgcgctacctcgccgaagacccggtgcaccgcaagtaccaccacggcgagctg
accttcagcatggtctatgcctatgccgagcgctacgtcctgccgctctcgcacgatgaa
gtggtgcacggcaagggatcgctgctgaacaagatgcccggcgacgtcaccgcccgcttc
gccaatttgcgcgcctacctgggctacatgtgggcccaccccggcaagaaactgctgttc
atgggcggcgagatcgcgcaggccgccgaatggaaccatgacgctccgctcgactggaac
ctgctggacgatccggcccgcaagggcatgcaacgactggtcggcgacctcaatcgcctg
taccgctcccagcccgcgctgcatgcccgtgacgccgatcccgccggctttgcctgggtc
gtgctggatgacgccgataacagcgtggtcgcctttctgcgcacggacggcgccgcgcag
gtgctggcggtcagcaacttcacgccggtggcgcgcgccgcctaccgcgtcggcgtgccg
ctgggcgggcgctgggacgagatcctgaacaccgacgccggcagctacggcggcaccggc
gccggcaatcttggccgggcgcaggcgcgcgccgaaccggcgcatggccatgcccagtcg
ctgttgctgacgctgccgccgctatccaccctttacttcctgcatcgagacgaatga

DBGET integrated database retrieval system