KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_059821Help
Entry
NH44784_059821    CDS       T02785                                 

Definition
4-alpha-glucanotransferase (amylomaltase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NH44784_059821
Enzymes [BR:axo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NH44784_059821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6429180..6431297
Genome map
AA seq 705 aa AA seqDB search
MSATLSALAMAAGLAEHWTDARQQPRAVAPDTLRALLRAMDLPADSEADIRDSHARLAAA
RSQARLPAMMVAVAGGRLRLPPACAGAYEISAAHARALAGHTTTDAAGMPELLLPTVPGY
YTLALPGGVTTLAVAPASAPPPSLLLDEPEPRAWGLAAQVYSLRRQAADPVQATHGFGDF
GALRDLAISAGAAGADALAMSPVHAMFAADPGQYSPYSPSSRLFLNTLYADPAAVLGAEA
VRAALARMGPAAQQALHALEQRDLIDWPQAARARQRLLRELHRGFQQTATADQRQALQAF
CRAGGQDLRDHALFEALHENLAQLPGAPRSWTAWPDGLRDPRSNETRGFAQAQAGELDFH
QFTQWLAAVSLSQAQQAARGAGMRIGLIADLAIGASPAGSHAWSHQADLMRRAGVGAPPD
IHNPLGQAWGLTALSPQALRESGYAAFIALLRAGLAQAGGLRIDHILGMARLWLIPDGAA
AADGAYLRYPLRTLLRLTALEAWRHRALMIGENLGTVPEGFDDALREHGLLGMDVLWFMR
EASAARSPAAFTAPGAWPAQAAAMTTTHDLPTLEGWWRGRDIDWRADLDLLSPQESAADL
RAARAADRESLWQAVRAHAHQPPEPAPEQVPAATLLAYVAAAPCPLALVPLEDATGMVDQ
PNLPGADSRHPNWRQRQPLAAADCLEAPAARERLAPLRSLRGRKP
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccacgctctcggcgctggccatggccgccggcctggccgagcattggaccgac
gcccgccagcagccgcgcgcggtcgcgcctgacaccttgcgcgccctgctgcgcgcgatg
gacctgcccgccgacagcgaggccgatatccgcgacagccacgcgcggctggccgcggcc
cgcagccaggcccggctgcccgcgatgatggtcgcggtagccgggggcaggctgcggctg
ccgcccgcctgcgccggcgcctacgaaatcagcgccgcgcatgcccgcgccctggccggc
cacaccaccacggacgcggccggcatgccagaactcctcctgcccacggtgcccggctac
tacacgctggcgctgccgggcggcgtcaccaccctggcggtggcgccggccagcgcgccg
ccgccctccctgttgctggacgaacccgagccgcgcgcatggggcctggccgcgcaggtc
tacagcctgcggcggcaggccgccgatcccgtccaggcgacccatggcttcggcgacttc
ggcgccctgcgcgacctggccatcagcgccggcgcggcaggcgccgacgcgctggccatg
agtccggtgcatgccatgtttgccgccgaccccggccaatacagcccctactcgccctcc
agccggctgttcctgaatacgctgtacgccgatcccgccgccgtgctcggcgccgaggcc
gtgcgcgcggcgcttgcgcgcatggggccggcggcgcaacaggcgctgcacgcgctggaa
caacgcgacctgatcgattggccccaggccgcgcgggcgcgccagcggctgttgcgcgag
ttgcaccgcggtttccagcagaccgccaccgcggaccagcgccaagcgctgcaggcattc
tgccgcgccggcggccaggacctgcgcgaccacgcgctgttcgaggcgttgcacgagaac
cttgcgcaactgcccggcgcgccgcgcagctggaccgcctggcccgacgggctgcgcgac
ccgcgctcgaacgagacccgcggcttcgcccaggcgcaggcgggtgaactggattttcat
caattcacgcaatggctggccgccgtcagcctgtcgcaggcgcagcaggcagcccgtggc
gccggcatgcgcatcggcttgatcgcggacctggcgatcggcgccagccccgccggcagc
cacgcctggagccaccaggccgacctgatgcggcgcgccggcgtgggcgccccgcccgat
atccacaaccccttgggccaggcctggggcctgaccgccctgtcgccccaggcgctgcgg
gaatcgggctacgccgccttcattgccctgctgcgcgccggcctggcgcaggcgggcgga
ctgcgcatcgaccatatcctgggcatggcgcgcctgtggctgattccggacggggcggcg
gcggccgacggcgcctatctgcgttatccgctgcgcacgctgctgcgcctgacggcgctg
gaggcctggcgccaccgggcgctgatgatcggcgagaacctgggcaccgtgcccgagggc
ttcgacgacgcgctgcgcgaacacggcctgctgggcatggacgtgctgtggttcatgcgc
gaagcgtccgcggcgcgctcgcccgccgcgttcacggcgccgggcgcctggcccgcgcag
gccgccgccatgaccacgacccatgacctgcccacgctggaaggctggtggcgcggccgc
gacatcgactggcgcgcggacctcgatcttctgagcccgcaggaaagcgcggccgacctg
cgcgccgcgcgcgccgccgatcgcgaaagcttgtggcaggccgtgcgcgcgcatgcccac
cagccgcccgaacccgcgccggaacaggtccccgcggctacgctgctggcctatgtggcg
gcggcgccgtgccccttggccctggtgccgctggaagacgccaccggcatggtcgaccag
cccaatctgccgggcgccgacagccgccatcccaactggcgccagcgccagccgctggcc
gccgccgattgcctggaggcgcccgccgcgcgcgaacggctggcgccgctacggtccctg
agagggcgcaagccatga

DBGET integrated database retrieval system