KEGG   Achromobacter xylosoxidans A8: AXYL_00190Help
Entry
AXYL_00190        CDS       T01341                                 

Gene name
hisD1
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:axy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:axy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(194393..195697)
Genome map
AA seq 434 aa AA seqDB search
MALINRLDSRDPGFKSALSTLLAFEATEDESIDRAAAGILADVRARGDAALVEYTQRFDR
MPGASAQTLEIPKADWHAALAALPAAQRNALEAAAERVRSYHERQRAETWTYTDADGTML
GQQVTPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVQELVMVTPTPDGVRNPIVLAAAA
IAGVDRVFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAAAKRRVFGVVGIDMIAGPS
EILVICDGKTPADWIAMDLFSQAEHDELAQSILLCPDAAFIEEVQASIERLLPTMPRADI
LRVSLANRGALILVQDLEEACRIANDIAPEHLEISTEQPEKWTAQIRHAGAIFMGRFSSE
SLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQVSHQGAQKLGRIAAELALGEGL
QAHAASAQYRIDQP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatcaatcgtctcgactcccgcgatcccggattcaaatccgccctgtccacg
ctgctggccttcgaggccaccgaggatgaatccatcgaccgcgccgcagccggcatcctg
gccgacgtgcgcgcccgcggcgatgccgcgctggtggaatacacgcagcgctttgaccgc
atgcccggcgcatcggcccagacgctggagatccccaaggcggactggcatgcggccctg
gccgcgctgccggccgcccagcgcaacgcgctggaagccgccgccgagcgcgtgcgcagc
taccacgaacgccagcgcgccgagacctggacctacaccgacgccgacggcaccatgctg
ggccagcaggtcaccccgctggaccgcgtgggcctgtacgtgcctggcggcaaggccgcc
tacccgtcctcggtgctgatgaacgccatcccggccaaggtcgcgggcgtgcaggaactg
gtcatggtcacgcccacgcccgacggcgtgcgcaaccccatcgtgctggccgccgcggcc
atcgccggcgtggaccgcgtcttcgccatcggcggcgcgcaggccgtgggcgcgttggcc
tatggcaccgccaccgtaccggccgtcgacaagatcgtcggcccgggcaacgcctacgtc
gccgccgccaagcgccgcgtgttcggcgtggtcggcatcgacatgatcgccggccccagc
gaaatcctggtcatctgcgacggcaagacgccggccgactggatcgccatggacctgttc
tcgcaggccgaacacgacgaactcgcgcaatccatcctgctgtgtccggacgccgccttc
atcgaagaggtgcaagcctcgatcgaacgcctgctgcccaccatgccgcgcgccgacatc
ctgcgcgtcagcctggccaaccgcggcgcgctgatcctggtccaggacctcgaagaagcc
tgccgcatcgccaacgacatcgcgcctgagcacctggagatctccaccgagcagcccgag
aagtggaccgcgcagatccgccacgccggcgccatcttcatgggccgcttcagctccgaa
tccctgggcgactactgcgccggccccaaccacgtgctgccgacctcgcgcacggcccgt
ttttcgtcgccgctgggcgtctatgacttccagaagcgctccagcctgatccaggtttcg
caccagggcgcccagaagctgggccgcatcgccgccgaactggcgctgggcgagggcctg
caggcgcacgccgccagcgcccagtaccggatcgaccagccatga

DBGET integrated database retrieval system