KEGG   Achromobacter xylosoxidans A8: AXYL_00337Help
Entry
AXYL_00337        CDS       T01341                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01130  Biosynthesis of antibiotics
axy01230  Biosynthesis of amino acids
Module
axy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXYL_00337 (trpC)
Enzymes [BR:axy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AXYL_00337 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADP13696
UniProt: E3HT70
Position
complement(354450..355238)
Genome map
AA seq 262 aa AA seqDB search
MNDILAKILAVKAEEVAAARQMRSEAEVLREAQARQDVRGFAQAIEDKISQGKAGVIAEI
KKASPSKGVLRDPFNPPEIASTYAVHGAACLSVLTDVQFFQGSHDHLRQARAACSLPVLR
KDFVIDPYQIIAARAMGADCVLLIVAALSPAQLRDYETLAMELGMDVLVEVHDAKELDIA
LTLKTPLLGINNRNLRTFETSLSNTLDLLPRIPAGKRVVTESGILKPEDVQLMRQHKVDA
FLVGEAFMRAKDPGAELARLVG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattctcgcgaagatcctcgccgtcaaggccgaggaagtcgccgccgctcgc
cagatgcgcagcgaagccgaagtcctgcgcgaagcacaggcgcggcaggacgtgcgtggc
tttgcccaagccatcgaagacaagatctcgcaaggcaaggccggcgtcatcgctgaaatc
aagaaagcctcgccctccaagggcgtgctgcgcgaccccttcaatcccccggaaatcgcc
tccacctatgcggtgcacggcgcagcctgcctgtcggtgctgaccgacgtgcagttcttc
cagggttcccacgaccacctgcgccaggcgcgcgcggcttgctcgctgccggtgctgcgc
aaggacttcgtgatcgacccgtaccagatcatcgccgcgcgcgccatgggcgcggactgc
gtgctgttgatcgtggccgcgctcagccccgcgcaactgcgcgactatgaaacgctggcg
atggagctgggcatggacgtgctggtggaagtgcacgacgccaaggaactcgacatcgcg
ctgaccctgaagacgccgctgctcggcatcaacaaccgcaacctgcgcaccttcgagacc
agcctgtcgaacacgctggacctgctgccccggattcccgcgggcaagcgcgtcgtgacc
gaaagcggcatcctcaagcccgaagacgtgcagctgatgcgccagcacaaggtcgatgcc
ttcctggtgggcgaagccttcatgcgcgccaaggatccgggcgcggaacttgcgcgcctg
gtgggctag

DBGET integrated database retrieval system