KEGG   Achromobacter xylosoxidans A8: AXYL_00346Help
Entry
AXYL_00346        CDS       T01341                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
axy  Achromobacter xylosoxidans A8
Brite
Enzymes [BR:axy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AXYL_00346
Secretion system [BR:axy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AXYL_00346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363290..364087
Genome map
AA seq 265 aa AA seqDB search
MNFRISATLAACFLAAGLGMSAGAAAQGDKSVSTQSVGQPGKGDKSYSTTQVAPADPVAD
AVKDRFRQRFDGMDVTAVRRTPYGLFEVQLGMDLIYTDEKVTWVMEGPLIDAMTRRDVTR
ETQERLSAVSFDQLPLDLAIKQVKGDGSRKVAIFEDPNCGYCKQLRKTLEDVDNITVYTF
LYPILSPDSKDKVRDVWCSKDPGAAWDDWMLRGKKPATANCDVPEDKLLALGQKLMVRGT
PTTFFADGSRVSGALPLEQFKARLN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccgcatatccgccactctggcggcttgtttcctggccgcgggcctgggcatg
tccgccggcgcagcggctcagggcgacaagtctgtctccacccagtccgtgggccagccc
ggcaagggcgacaagagctactccaccacccaggtggcgccggccgaccccgtggcggac
gcggtcaaggatcgctttcgccagcgtttcgacggcatggacgtgacggccgtgcgccgc
acgccttacggcctgtttgaagtgcagctgggcatggacctgatctacacagatgaaaag
gtgacctgggtcatggaaggtccgttgatcgacgccatgacgcgccgcgacgtcacccgc
gaaacgcaggagcgcctgagcgccgtgtcattcgatcagctgccgctggacctggccatc
aagcaggtcaagggcgacggctcgcgcaaggtcgcaattttcgaggaccccaattgcggc
tactgcaagcaattgcgcaagacgctggaagacgtcgacaacatcaccgtctacaccttc
ctctatcccatcctgtcgccggattccaaggacaaggtgcgcgacgtgtggtgctccaag
gatcctggcgccgcctgggacgactggatgctgcgcggcaagaagcccgccaccgcgaat
tgcgacgtgcccgaggacaagctgctggccctgggccagaagctgatggtgcgcggcacg
ccgaccaccttctttgcagacggctcgcgcgtcagtggcgccttgcccctggagcaattc
aaagcccgcttgaactga

DBGET integrated database retrieval system