KEGG   Achromobacter xylosoxidans A8: AXYL_00504Help
Entry
AXYL_00504        CDS       T01341                                 

Gene name
pcm1
Definition
methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
axy  Achromobacter xylosoxidans A8
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(528776..529456)
Genome map
AA seq 226 aa AA seqDB search
MNASTLPDVEQARFNMVEQQIRPWDVLDANVLQALFDVRREQFVPPALRALAFSDLELPL
EINAVNTRQNMLAPKVEARLAQELLLTKSDCVLEIGTGSGYQAALLGYLAQQVTSVEIDS
RLVTFAQQNLQMSNVTNVKVETGDARNGWGSTEYDAILVTGSVPTVPDALKYQLRVGGRL
VVVVGQAPVMTACRITRTTAASFETVNLFETVIKPLRGVAVSQFKF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttcgaccctgcccgacgtagaacaagcccgcttcaacatggtggaacagcag
atccgcccctgggatgttctggacgccaacgtgctgcaagcgctgttcgatgtgcgccgc
gaacaattcgttccgccggccctgcgcgcgctggcgttttccgacctggaactgccgctt
gagatcaacgcggtcaacacccgccagaacatgctggcgcccaaggtggaagcccgcctg
gcgcaagagctgctgctgaccaagtccgactgtgtgctggaaatcggcaccggctccggc
taccaggccgcgctgctgggctacctggcgcagcaggtcacctcggtcgagatcgacagc
cgcctggtgacgttcgcgcagcagaacctgcagatgagcaacgtcaccaacgtcaaggtc
gaaaccggcgatgcccgcaacggctggggctccaccgaatacgacgccattctcgtcacg
ggttccgtgccgaccgtccccgacgcgctgaagtaccagctgcgcgtgggcggccgcctg
gtcgtggtcgtgggccaggcccccgtcatgaccgcctgtcgcatcacccgcaccactgcg
gccagcttcgaaaccgtgaacctgttcgaaaccgtcatcaagccgctgcgcggcgtcgcg
gtctcgcagttcaagttctga

DBGET integrated database retrieval system