KEGG   Achromobacter xylosoxidans A8: AXYL_00544Help
Entry
AXYL_00544        CDS       T01341                                 

Gene name
glpK
Definition
(RefSeq) glycerol kinase (EC:2.7.1.30)
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AXYL_00544 (glpK)
Enzymes [BR:axy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AXYL_00544 (glpK)
Exosome [BR:axy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXYL_00544 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(575859..577325)
Genome map
AA seq 488 aa AA seqDB search
MFDREGVVRGVGQREFRQHYPRPGWVEHDASEIWHSQLDVAREALRNAGATAADIAAIGI
TNQRETTVIWERATGRPLARAIVWQDRRTAPMCDQLRQDGHADFLQSRTGLVLDAYFSGT
KLAWLLDHVPGARQMAERGELAFGTVDTWLIWQLTGGAVHSTDPSNASRTMLFDLHTQDW
NDEILALLKIPRSVLPAIAPSSAVVGEALPEWLGGSIPIAGVAGDQQAATFGQACFTPGM
AKNTYGTGCFMLMNVGDKPVQSRNHLLSTVGWGLPQAGNGGWRPTYMLEGGVFVAGAAVQ
WLRDGLGIIQRSEEIESLAASVADTDDVFMVPAFAGLGAPHWDPYARGTLVGLTRGTTRA
HIARATLESIALQSAELLTCMNGDSGIALTELRVDGGAARNDLLMQMQADLLGVPVVRPR
VSESTALGAAGLAGLAVGFWSGLDEFASKWQAERTFEPTWPESVRAARMKRWRQAVELSK
GWSDSAGK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgaccgcgaaggcgtggtgcgcggcgtaggccagcgcgaattccgccagcactat
ccgcggccgggctgggtcgaacacgacgccagcgagatctggcacagccagctggacgtg
gcgcgcgaggctctgcgcaacgccggcgcgaccgccgccgacattgccgccatcggcatc
accaaccagcgcgaaaccaccgtgatctgggaacgcgccacgggccgccctctggcccgc
gccatcgtctggcaggaccgccgaacagcgccgatgtgcgaccagctgcgccaggacggc
cacgccgatttcctgcaatcgcgcaccggcctggtgctggacgcctatttctccggcacc
aagcttgcctggctgctggaccacgtacccggggcgcgccagatggccgaacgcggcgag
ctggccttcggcaccgtggacacctggctgatctggcaactgaccggcggcgcggtgcac
agcaccgaccccagcaatgcgtcgcgcaccatgctgttcgacctgcacacgcaggactgg
aacgacgagatcctggcgctgctcaagattccgcgcagcgtgctgccggcaatcgcgccc
agcagcgcggtggtgggcgaagctctgcccgaatggctgggcggctccatccccatcgcc
ggcgtggctggcgaccagcaggccgccaccttcggccaggcctgcttcacgccgggcatg
gccaagaacacctacggcaccggctgcttcatgctgatgaacgtgggcgacaagccggtg
caatcccgcaaccacctgctgtccacggtaggctggggcctgccgcaggccggcaatggc
ggctggcgcccgacctacatgctggaaggcggcgtgttcgtggccggcgccgcggtgcaa
tggctgcgcgacgggctgggcatcatccagcgctctgaagaaatcgaatccctggccgcc
agcgtggccgacaccgacgacgtcttcatggtcccggccttcgccggcctgggcgcgccg
cactgggacccttatgcgcgcggcacgctggtgggcctgacccgcggcaccacccgcgcc
cacatcgcccgcgccacgctggaatccatcgcgctgcaaagcgcggaactgctgacctgc
atgaacggcgacagcggcatcgcgctgaccgagctgcgcgtggacggcggcgcggcgcgc
aacgacttgctaatgcagatgcaggcggacctgctgggcgtcccggtggtgcgtccacgc
gtgtcggaatcgacggcgctgggggccgcggggttggcggggctggcggtgggtttctgg
tctggactggatgagtttgcctcgaagtggcaggcggaacggacgttcgagccgacttgg
ccggagtctgtgcgggctgcgcggatgaagcggtggaggcaggctgtggagttgtccaag
ggctggtcggatagtgctgggaagtag

DBGET integrated database retrieval system