KEGG   Achromobacter xylosoxidans A8: AXYL_00791Help
Entry
AXYL_00791        CDS       T01341                                 

Gene name
ddl
Definition
D-alanine--D-alanine ligase B (EC:6.3.2.4)
Orthology
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:axy00473]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:axy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
842892..843842
Genome map
AA seq 316 aa AA seqDB search
MSTQFGKVGVLYGGRSAEREVSLMSGAGVHQALLSAGVDAHLFDTGERSLSELAAQGFDR
VFIALHGRYGEDGTIQGALELLGIPYTGSGPLASALAMDKTMTKRVWLQHGLPTPDFELL
DADTELRLVPDRLSLPLIIKPPHEGSTVGITKVVGYSDMKEAYAAAARFDAEVLAEQFIT
GRELTVAVLGGGKTARALPVIEIAAPGGNYDYEHKYFSDDTQYFCPATLPPEVAAEVAEI
AVQAYQALGCEGWGRADFILDRDNRPWLLEMNTSPGMTSHSLVPMAAKAVGISYADLCVA
ILSEAACKVRSPARNA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcaattcggcaaagtgggtgtgttgtacggcgggcgctccgccgaacgcgaa
gtgtccttgatgtcgggcgcgggcgtgcaccaggcgctgctcagcgccggcgtggacgcg
cacctgttcgacacgggcgagcgcagcctgtccgagctggccgcccaaggcttcgaccgc
gtgttcatcgctttgcacggccgctatggcgaagacggcaccatccagggggcgctggaa
ctgctgggcatcccctacaccggcagcggcccgctggcgtccgcgctcgccatggacaag
accatgaccaagcgcgtgtggctgcagcacggcctgcccacgcccgactttgaattgctg
gatgcggacaccgaactgcgcctggtgccggaccgcctgagcctgccgctgatcatcaag
ccgccgcacgaaggatcgacggtgggcattaccaaggtggtgggctattccgacatgaag
gaagcctacgccgcagcggcccgtttcgacgccgaagtgctggccgagcagttcatcacc
ggccgcgagctgaccgtggcggtgctgggcggcggcaagaccgcgcgcgcgctgcccgtc
atcgagatcgccgcgcctggcggcaattacgactacgagcacaagtacttctccgacgac
acgcagtacttctgcccggccaccttgccgcccgaagtggccgcggaagtcgccgagatc
gcggtccaggcttaccaggcgctgggctgcgaaggctggggccgcgccgatttcatcctc
gaccgcgacaaccggccgtggctgcttgaaatgaatacctcgcctggcatgaccagccat
tcactcgttcccatggccgccaaggcggtgggaatcagctacgccgacctgtgcgtggcg
atcttgtccgaggccgcgtgcaaagtgcgcagcccggcccgtaacgcttga

DBGET integrated database retrieval system