KEGG   Achromobacter xylosoxidans A8: AXYL_00791Help
Entry
AXYL_00791        CDS       T01341                                 

Gene name
ddl
Definition
D-alanine--D-alanine ligase B (EC:6.3.2.4)
Orthology
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXYL_00791 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXYL_00791 (ddl)
Enzymes [BR:axy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AXYL_00791 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
842892..843842
Genome map
AA seq 316 aa AA seqDB search
MSTQFGKVGVLYGGRSAEREVSLMSGAGVHQALLSAGVDAHLFDTGERSLSELAAQGFDR
VFIALHGRYGEDGTIQGALELLGIPYTGSGPLASALAMDKTMTKRVWLQHGLPTPDFELL
DADTELRLVPDRLSLPLIIKPPHEGSTVGITKVVGYSDMKEAYAAAARFDAEVLAEQFIT
GRELTVAVLGGGKTARALPVIEIAAPGGNYDYEHKYFSDDTQYFCPATLPPEVAAEVAEI
AVQAYQALGCEGWGRADFILDRDNRPWLLEMNTSPGMTSHSLVPMAAKAVGISYADLCVA
ILSEAACKVRSPARNA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcaattcggcaaagtgggtgtgttgtacggcgggcgctccgccgaacgcgaa
gtgtccttgatgtcgggcgcgggcgtgcaccaggcgctgctcagcgccggcgtggacgcg
cacctgttcgacacgggcgagcgcagcctgtccgagctggccgcccaaggcttcgaccgc
gtgttcatcgctttgcacggccgctatggcgaagacggcaccatccagggggcgctggaa
ctgctgggcatcccctacaccggcagcggcccgctggcgtccgcgctcgccatggacaag
accatgaccaagcgcgtgtggctgcagcacggcctgcccacgcccgactttgaattgctg
gatgcggacaccgaactgcgcctggtgccggaccgcctgagcctgccgctgatcatcaag
ccgccgcacgaaggatcgacggtgggcattaccaaggtggtgggctattccgacatgaag
gaagcctacgccgcagcggcccgtttcgacgccgaagtgctggccgagcagttcatcacc
ggccgcgagctgaccgtggcggtgctgggcggcggcaagaccgcgcgcgcgctgcccgtc
atcgagatcgccgcgcctggcggcaattacgactacgagcacaagtacttctccgacgac
acgcagtacttctgcccggccaccttgccgcccgaagtggccgcggaagtcgccgagatc
gcggtccaggcttaccaggcgctgggctgcgaaggctggggccgcgccgatttcatcctc
gaccgcgacaaccggccgtggctgcttgaaatgaatacctcgcctggcatgaccagccat
tcactcgttcccatggccgccaaggcggtgggaatcagctacgccgacctgtgcgtggcg
atcttgtccgaggccgcgtgcaaagtgcgcagcccggcccgtaacgcttga

DBGET integrated database retrieval system