KEGG   Achromobacter xylosoxidans A8: AXYL_00840Help
Entry
AXYL_00840        CDS       T01341                                 

Definition
thermostable monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Brite
Enzymes [BR:axy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AXYL_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899100..899963
Genome map
AA seq 287 aa AA seqDB search
MSQQRVGALLIHGLGGTEFDMGAMHKVLARAGIEPHGVTLPGHAGCPEDLLDVRVEDWMA
VVTQRYRELCAQYEVLHVIGMCLGALLAVELCKRESHTRGALVSLSAPVFLDGWSTPWYR
ALRYLVYRLPGLPRRMRVREEDPYGVKSELVRAFIKAGFARGDGFHYQWVPLACVRQVDR
LRGMVQRGLERMRCPTLIMHAEEDELTSPRSARFLARRIPEATVVMLQDSYHMICVDQER
ERVMRNVLGFLGKDPDIVRMRRRSRVPDADTHPTPAMLAQASHSCAG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcaacgcgtcggcgcactgctcatccacggcttgggcggcaccgaattcgac
atgggcgccatgcacaaggtgctggcgcgcgccgggatcgagccccacggcgtgaccttg
cccggccatgccggttgtccggaagacctgcttgatgtgcgggtcgaggactggatggcg
gtggtcacgcagcgctatcgcgaactctgcgcgcagtacgaggtgctgcacgtcatcggg
atgtgcctgggcgccttgctggcggtggaactgtgcaagcgcgaatcgcacacgcggggc
gcgctggtgtcgctgtccgcgccggtattcctggatgggtggagcacgccctggtatcgg
gccttgcgttatctggtgtaccgcctgccgggcctgccgcgccggatgcgggtgcgcgaa
gaggatccatacggcgtgaagagcgagctggtgcgcgctttcatcaaggcgggctttgcg
cgcggcgacggcttccattatcaatgggtgccgctggcttgcgtgcgccaggtggaccgg
ctgcgcggcatggtccagcgggggctggagcgcatgcgctgtcccaccttgatcatgcac
gcggaagaggatgaactgaccagtccgcgttcagcccgtttcctggcgcggcgcataccg
gaggcgacggtggtgatgctgcaggacagctaccacatgatctgtgtggatcaggaacgc
gagcgcgtgatgcgcaacgtcctgggatttttgggcaaggacccggacatcgtccggatg
cgcagacgttcgcgcgtgcccgacgccgatacccatcccacgccggccatgctggcgcaa
gccagccattcctgcgcgggctga

DBGET integrated database retrieval system