KEGG   Achromobacter xylosoxidans A8: AXYL_00989Help
Entry
AXYL_00989        CDS       T01341                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:axy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1068439..1069011)
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKLPPTICVDVGGLGYDIDVPMSTLYSLPDTGARVTLYTHLTVREDAHIL
YGFASAGERSAFRELIKVSGIGARTALSVLSGLSVADLAQAITLQESGRLTRVPGIGKKT
AERLLLEMRGKLGADIGASPHAAPDNQSDILNALLALGYSEKESLSALKTLPEGVGVSDG
IKQALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcatcaccggaaccctgatcgaaaaactcccgcccaccatctgtgtggac
gtgggcggtctgggctatgacatcgacgtgcccatgagcacgctgtattcgctgcccgac
accggcgcccgcgtcacgctctacacgcacctgacggtgcgcgaagacgcccacatcctg
tatggcttcgcgtcggccggcgagcgcagcgcattccgcgaactgatcaaggtcagcggc
atcggcgcgcgcaccgcgttgtcggtgctgtcgggcctgtcggtggcggatctggcccag
gccatcaccttgcaggaatcgggccgcctgacgcgcgtgcccggcatcggcaagaagacc
gccgaacgcctgctgctggaaatgcgcggcaagctgggcgcggacatcggtgcgtcgccg
cacgcggcgcccgacaaccagtcggacatcctgaacgcgctgctggcgctgggctactca
gagaaggaatcgctgtcggcgctgaagaccctgccggaaggcgtgggcgtgtccgacggc
atcaagcaggccttgaaggcgctggtgcgctga

DBGET integrated database retrieval system