KEGG   Achromobacter xylosoxidans A8: AXYL_01007Help
Entry
AXYL_01007        CDS       T01341                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AXYL_01007 (galU)
   00052 Galactose metabolism
    AXYL_01007 (galU)
   00500 Starch and sucrose metabolism
    AXYL_01007 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AXYL_01007 (galU)
Enzymes [BR:axy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AXYL_01007 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1087493..1088344)
Genome map
AA seq 283 aa AA seqDB search
MRPVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDSAPELESDLESKGKHELLAMVRGILPAHVNCLYIRQSAPLGLGHAVLSAAP
AVGDEPFAVLLADDLIDSDQPALKQLIEVAVAQNASVLGVQDVPRADTRKYGIVATRQGD
ASAHGRTERVTHIVEKPDPEAAPSTLAVVGRYVLEAAIFDHLRSTKMGAGNEIQLTDGIA
SLMRERAVYAHRYEGVRYDCGSKAGMFQATVALGKKYHGLLPE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctgtccgtaaagctgttttccctgtcgccggcatgggcacgcgcttcctgccc
gccaccaaggcgatgcccaaggaaatgctgcccgtggtcgacaagccgctgatccaatat
gccgtggaagaagccgtggccgccggaatcacggaccttatcttcgtgacggggcgcaat
aagcgcgccatcgaagaccacttcgattccgcgccggaactcgaatcggacctggaaagc
aagggcaagcatgagcttctggccatggtgcggggcattctacccgcgcatgtgaattgc
ctctatatccgccaatcggcgccgctgggcttgggccatgcggtgctgtccgccgcgccc
gccgtgggcgacgaaccctttgccgtgctgctggccgacgacctgatcgactccgaccag
cccgcgctgaagcagctgatcgaggtggccgtggcgcagaacgccagtgtgctgggcgtg
caggacgtgccgcgcgccgatacccgcaagtacggcatcgtggccacccgccagggggat
gccagcgcccacggccgcaccgaacgcgtcacccatatcgtggaaaaaccggatcccgaa
gccgcgccgtcgacgctggccgtggtgggccgctatgtgctggaagcggcgattttcgac
cacctgcgttcgaccaagatgggcgctggcaacgagatccagctgaccgacggcattgcc
tcgctgatgcgcgagcgcgccgtgtatgcgcaccgctatgaaggcgtgcgttatgactgc
ggcagcaaggccggcatgttccaggccaccgtggcgctgggcaagaagtaccacggcctg
ctgccggaatag

DBGET integrated database retrieval system