KEGG   Achromobacter xylosoxidans A8: AXYL_01261Help
Entry
AXYL_01261        CDS       T01341                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:axy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:axy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:axy00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:axy00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:axy00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332782..1333528
Genome map
AA seq 248 aa AA seqDB search
MTSVENRARLVLGNWKMHGNLAENAALLTELRAADAARHCEIGICVPFPYLAQAASALTG
SSVSWGAQDVSAHDKGAYTGEVSGAMLKEFGCRWALAGHSERRVLHGETDEIVAAKAQAA
LAAGLTPVVCVGESLADREAGNTLTVIERQLKPVLALGAEAVSRVVLAYEPVWAIGTGRT
ASPEQAQEVHGAIRAALRALGAAQVQVLYGGSVKAANAASLFAMTDIDGALVGGASLVAE
EFLRIAAI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagtcgaaaaccgcgcccgcctcgtgctgggcaactggaagatgcacggcaac
ctggccgagaacgccgcgttgctgaccgagttgcgcgccgcggatgctgcgaggcactgc
gaaatcggcatctgtgtgccgtttccctatctcgcgcaggcggcgtcggccctgaccggc
agcagcgtgtcgtggggcgcgcaagacgtcagcgcccatgacaagggcgcctacaccggg
gaagtgtccggcgccatgctgaaggaattcggctgccgctgggccctggccggccattcc
gagcgccgcgtgctgcatggagagaccgacgaaatcgtcgccgccaaggcccaggccgcg
ctggccgccggcctgaccccggtcgtgtgcgtgggcgaatccctggccgaccgtgaagcc
ggcaacacgctgaccgtgatcgaacgccagttgaagcccgtgctggcgctgggcgccgag
gcggtatcgcgcgtggtcctggcctatgaacccgtctgggccatcggcaccggccgcacc
gccagccccgagcaggcgcaagaagtccatggcgcgatccgcgccgccctgcgcgcgctg
ggcgcggcgcaggtgcaagtgttgtacggcggcagcgtcaaggctgccaatgccgccagt
ttgttcgccatgaccgatatcgacggggccctggtcggtggcgcgtcgctcgtggccgaa
gaatttttgcgaatcgccgctatctaa

DBGET integrated database retrieval system