KEGG   Achromobacter xylosoxidans A8: AXYL_01261Help
Entry
AXYL_01261        CDS       T01341                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AXYL_01261 (tpiA)
   01230 Biosynthesis of amino acids
    AXYL_01261 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_01261 (tpiA)
   00051 Fructose and mannose metabolism
    AXYL_01261 (tpiA)
   00562 Inositol phosphate metabolism
    AXYL_01261 (tpiA)
Enzymes [BR:axy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AXYL_01261 (tpiA)
Exosome [BR:axy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AXYL_01261 (tpiA)
  Exosomal proteins of bladder cancer cells
   AXYL_01261 (tpiA)
  Exosomal proteins of melanoma cells
   AXYL_01261 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332782..1333528
Genome map
AA seq 248 aa AA seqDB search
MTSVENRARLVLGNWKMHGNLAENAALLTELRAADAARHCEIGICVPFPYLAQAASALTG
SSVSWGAQDVSAHDKGAYTGEVSGAMLKEFGCRWALAGHSERRVLHGETDEIVAAKAQAA
LAAGLTPVVCVGESLADREAGNTLTVIERQLKPVLALGAEAVSRVVLAYEPVWAIGTGRT
ASPEQAQEVHGAIRAALRALGAAQVQVLYGGSVKAANAASLFAMTDIDGALVGGASLVAE
EFLRIAAI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagtcgaaaaccgcgcccgcctcgtgctgggcaactggaagatgcacggcaac
ctggccgagaacgccgcgttgctgaccgagttgcgcgccgcggatgctgcgaggcactgc
gaaatcggcatctgtgtgccgtttccctatctcgcgcaggcggcgtcggccctgaccggc
agcagcgtgtcgtggggcgcgcaagacgtcagcgcccatgacaagggcgcctacaccggg
gaagtgtccggcgccatgctgaaggaattcggctgccgctgggccctggccggccattcc
gagcgccgcgtgctgcatggagagaccgacgaaatcgtcgccgccaaggcccaggccgcg
ctggccgccggcctgaccccggtcgtgtgcgtgggcgaatccctggccgaccgtgaagcc
ggcaacacgctgaccgtgatcgaacgccagttgaagcccgtgctggcgctgggcgccgag
gcggtatcgcgcgtggtcctggcctatgaacccgtctgggccatcggcaccggccgcacc
gccagccccgagcaggcgcaagaagtccatggcgcgatccgcgccgccctgcgcgcgctg
ggcgcggcgcaggtgcaagtgttgtacggcggcagcgtcaaggctgccaatgccgccagt
ttgttcgccatgaccgatatcgacggggccctggtcggtggcgcgtcgctcgtggccgaa
gaatttttgcgaatcgccgctatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system