KEGG   Achromobacter xylosoxidans A8: AXYL_01408Help
Entry
AXYL_01408        CDS       T01341                                 

Definition
(GenBank) alpha/beta hydrolase fold family protein 6
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00020  Citrate cycle (TCA cycle)
axy00620  Pyruvate metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
Module
axy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_01408
   00020 Citrate cycle (TCA cycle)
    AXYL_01408
   00620 Pyruvate metabolism
    AXYL_01408
Enzymes [BR:axy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXYL_01408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Hydrolase_4 Abhydrolase_1 Biotin_lipoyl E3_binding Thioesterase Ser_hydrolase Abhydrolase_8 Biotin_lipoyl_2 Abhydrolase_5 DUF3530 Peptidase_S15 Lipase_3 VirJ PGAP1 LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: ADP14746
UniProt: E3HQT8
Position
1483024..1484385
Genome map
AA seq 453 aa AA seqDB search
MTRTLDMVVPPTGEALDAARLVAWIVTPGQAFKAGDVLVEIETDKSIIEVPAHDDGVMVE
HLVAVDGIVNADTVIARIQMEGEGTPVPAPRAAVAAQPTSAKPAGAAQADAPAATQVPPV
SKPAPQPAEVSPPAARKFATPAARRVAAERGIALDGVQGSGPNGRVTVADVGQAGIDGQD
RMQARGAPGEKREVWASTRHGDVRVTLWEGSRAGSQTAVLIHGMFGDRDAWASLAHALSR
AGLRVLAMDLPCHGATRSQATRFEHVVDAVADTVTAQCNGSVTLIGHSFGAAVAARAASR
PGMAVDGLILIAPVGLGTEIDQSFLTGMTHAGTNEAAQRELQKLTVSGMTPSGNFIDALR
QSTQARRESLIELCREVGWNGVQQLSIVADLANLACRCTLIHGRRDAVIPWRHALNAPPR
TALHLLPDAGHMPQWEAGKLVADIVLDAVAATR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaacgctggatatggtcgtcccgccgacgggcgaggccctggacgcggcccgc
ctggtcgcctggatcgtgacgccgggccaggccttcaaggcaggcgacgtgttggtcgag
atcgaaacggacaagtccatcatcgaggtgcccgcgcatgatgacggggtcatggtggag
catctcgtcgccgtggacggcatcgtgaacgcggatacggtgatagcaagaatccagatg
gaaggcgaggggacgccagtgccggctccgcgtgctgccgtggcggcgcagcctacttcc
gccaagcccgcaggggctgcgcaggcggatgcgcccgctgccacgcaggtgccgccggtg
tcgaaaccagcaccgcagccggcggaggtctcgccgccagcagcgcgcaagtttgccact
cccgccgcccgccgcgttgcggccgagcgaggcatcgcgctggacggggtgcaagggtcg
ggcccgaacggccgtgtgaccgtggcggacgtcgggcaggcaggcattgatggacaggac
cgcatgcaggcccgaggggcgccgggagaaaagcgtgaggtttgggcttccacacgccac
ggcgatgttcgcgtgaccctgtgggaaggaagccgtgccggcagccagaccgccgtgctc
atccacggcatgttcggcgaccgcgacgcctgggccagcctggcgcacgcgctcagccgc
gccggactgcgggtgctggccatggatctgccttgccacggcgccacgcgctcgcaggcg
acgcgcttcgagcatgtggtggatgcagtggccgatacggtcacggcccaatgcaacggt
tccgtgacgctgatcggccattccttcggcgccgccgtggcagcccgggccgcgtcccgg
cccgggatggccgtggacggcctgatcctgatcgcgccggtcggactgggcacggagatc
gatcagagctttctcacgggcatgacgcatgccggcaccaacgaggccgcgcagcgcgaa
ctgcagaagctcaccgtctccggcatgacgccctcgggcaacttcatcgacgccttgcgg
caaagcacccaggcgcgccgcgaatcgctgatcgaactgtgcagggaagtcggctggaac
ggcgtgcagcaactgagcatcgtcgcggacctggccaatctcgcatgccgctgcacgctg
attcacggccggcgcgacgccgtcattccgtggcgtcacgccctcaacgcgccgccgagg
accgcgctgcatctgctgccggacgccggccacatgccgcaatgggaagccggcaagctg
gtggcggatatcgtgttggatgcggtggcggcgacgcgctga

DBGET integrated database retrieval system