KEGG   Achromobacter xylosoxidans A8: AXYL_01526Help
Entry
AXYL_01526        CDS       T01341                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase, beta subunit 1 (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXYL_01526 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_01526 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXYL_01526 (trpB1)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AXYL_01526 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1618247..1619446
Genome map
AA seq 399 aa AA seqDB search
MKPYDFPDAQGHFGPYGGVFVAETLMHALDELRAAYDHYRVDPAFQEEFNYELKHFVGRP
SPVYHARRWSEMVGGAQIWFKREDLNHTGAHKVNNCIGQALLAKRMGKPRVIAETGAGQH
GVATATVAARYGMECVVYMGSEDVRRQASNVYRMKLLGATVVPVNSGSRTLKDALNEAMR
DWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGNECLTQMPEAAGRQPDYVVAAVGGGS
NAMGIFHPYIPYENVRLIGVEAAGEGMDSGRHAASLAAGQVGVLHGNRTYVMQDADGQVQ
ETHSVSAGLDYPGVGPEHAWLKDSGRAEYVGITDAEALKAFHDCCRIEGIMPALESSHAI
AQAVKMAATLPRDAVILVNLSGRGDKDMHTVAEQAGIEL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgactttccggatgcccagggccatttcggcccttatggcggtgttttc
gtggcggaaacgctgatgcacgcgctcgacgagctgcgcgcggcctatgaccattaccgt
gtcgaccccgccttccaggaagagttcaactacgaactcaagcatttcgtgggccgtccc
agcccggtctaccatgcccgccgctggtcggaaatggtgggcggcgcccagatctggttc
aagcgcgaagacctgaaccacaccggcgcccacaaggtcaacaactgcatcggccaggca
ttgctggccaagcgcatgggcaagccccgcgtcatcgccgaaaccggcgctggccagcac
ggcgtggccaccgccacggtggcggcccgctacggcatggaatgcgtggtctacatgggc
agcgaagacgtccgccgccaggcgtcgaacgtctaccgcatgaagctgctgggcgccacg
gtggtgccggtcaactccggctcgcgcaccctgaaggacgcgctcaacgaagccatgcgc
gactgggtcaccaacattgaaaacaccttctacatcatcggcacggtggcgggtcccgac
ccctatccccgcatggtgcgcgatttccagaccgtcatcggcaacgaatgcctgacgcag
atgcctgaagccgctggccgccagcccgactacgtcgtggcggcggtgggcggcggctcc
aacgccatgggcatcttccatccctatattccctacgaaaacgtgcgcctgatcggcgtc
gaggcggcgggcgagggcatggacagcggccgccacgccgcttccctggccgcgggccag
gtgggcgtgctgcatggcaaccgcacctacgtcatgcaggacgccgacggccaggtccag
gaaacccattcggtctccgccggcctggactatcccggcgtcggtccggaacatgcctgg
ctgaaggactccggccgcgccgaatacgtcggcatcaccgacgcggaagccctcaaggcc
ttccacgactgctgccgcatcgaaggcatcatgcctgcgctggagtcgtcgcacgccatc
gcgcaagccgtgaagatggccgccacgctgccgcgcgacgccgtcatcctggtcaacttg
tcgggccgtggcgacaaagacatgcataccgtggccgaacaggccggcatcgagctctga

DBGET integrated database retrieval system