KEGG   Achromobacter xylosoxidans A8: AXYL_01527Help
Entry
AXYL_01527        CDS       T01341                                 

Gene name
trpA1
Definition
tryptophan synthase subunit alpha 1 (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXYL_01527 (trpA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_01527 (trpA1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXYL_01527 (trpA1)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AXYL_01527 (trpA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1619457..1620320
Genome map
AA seq 287 aa AA seqDB search
MTTRTDRIAAAFARTAESGRAAALIPYIAAGDPSPAATVPLMHALVEAGADVIELGVPFS
DPMADGPVIQRAADRAIAQGVGLARVLDLVAEFRQRDTATPVVLMGYANPIERMGQAEFA
RRAEQAGVDGVLVVDYPPEEVVEFAATLGEHGIAPIFLLAPTSTEARIKAVAAVARGYVY
YVSLKGVTGSGSLNTDDVAERLAVIRRHVRDIPVGVGFGIRDAESAQRVARAADAVVIGS
KLIETMEQAAADAPAAQKTDAAVTAASGWLRTIRQALDQVKRASASA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcgcaccgaccgcatcgccgccgcttttgcgcgcaccgccgaatccggccgc
gccgcggcgctgattccctacattgccgcgggcgatccctcgcccgccgccaccgttccc
ctgatgcacgcgctggtcgaggccggcgccgacgtcatcgaactgggcgtaccgttctcc
gatcccatggccgacggcccggtgatccagcgcgccgccgaccgcgccatcgcgcagggc
gtgggcctggcccgcgtgctggacctggtggccgagttccgtcagcgcgacaccgccacg
ccggtggtgctgatgggttacgccaacccgatagaacgcatgggccaggccgagttcgcg
cgccgcgccgagcaggctggcgtggacggcgtgctggtggtggactatccgcccgaagaa
gtcgtcgagttcgcggccacgctgggcgagcatggcatcgccccgatcttccttttggcg
cccacgtccacggaagcgcgcatcaaggccgtagccgcggtcgcccgcggctacgtgtac
tacgtgtcgctcaagggcgtcacgggttcgggctcgctcaataccgatgacgtggccgag
cgtttggccgtgatccgccgccacgtgcgcgatattccggtaggcgtgggcttcggcatc
cgcgacgccgaaagcgcccagcgcgtggcgcgcgcggccgacgccgtcgtgatcggcagc
aaactgattgaaaccatggagcaggcggcggcggacgcccccgcggcccagaaaaccgac
gccgcagtcaccgccgccagcggctggctgcgcaccatccggcaagcgctggatcaagta
aaacgagcaagcgcgtcggcctga

DBGET integrated database retrieval system