KEGG   Achromobacter xylosoxidans A8: AXYL_01527Help
Entry
AXYL_01527        CDS       T01341                                 

Gene name
trpA1
Definition
(GenBank) tryptophan synthase, alpha subunit 1 (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXYL_01527 (trpA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_01527 (trpA1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXYL_01527 (trpA1)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AXYL_01527 (trpA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1619457..1620320
Genome map
AA seq 287 aa AA seqDB search
MTTRTDRIAAAFARTAESGRAAALIPYIAAGDPSPAATVPLMHALVEAGADVIELGVPFS
DPMADGPVIQRAADRAIAQGVGLARVLDLVAEFRQRDTATPVVLMGYANPIERMGQAEFA
RRAEQAGVDGVLVVDYPPEEVVEFAATLGEHGIAPIFLLAPTSTEARIKAVAAVARGYVY
YVSLKGVTGSGSLNTDDVAERLAVIRRHVRDIPVGVGFGIRDAESAQRVARAADAVVIGS
KLIETMEQAAADAPAAQKTDAAVTAASGWLRTIRQALDQVKRASASA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcgcaccgaccgcatcgccgccgcttttgcgcgcaccgccgaatccggccgc
gccgcggcgctgattccctacattgccgcgggcgatccctcgcccgccgccaccgttccc
ctgatgcacgcgctggtcgaggccggcgccgacgtcatcgaactgggcgtaccgttctcc
gatcccatggccgacggcccggtgatccagcgcgccgccgaccgcgccatcgcgcagggc
gtgggcctggcccgcgtgctggacctggtggccgagttccgtcagcgcgacaccgccacg
ccggtggtgctgatgggttacgccaacccgatagaacgcatgggccaggccgagttcgcg
cgccgcgccgagcaggctggcgtggacggcgtgctggtggtggactatccgcccgaagaa
gtcgtcgagttcgcggccacgctgggcgagcatggcatcgccccgatcttccttttggcg
cccacgtccacggaagcgcgcatcaaggccgtagccgcggtcgcccgcggctacgtgtac
tacgtgtcgctcaagggcgtcacgggttcgggctcgctcaataccgatgacgtggccgag
cgtttggccgtgatccgccgccacgtgcgcgatattccggtaggcgtgggcttcggcatc
cgcgacgccgaaagcgcccagcgcgtggcgcgcgcggccgacgccgtcgtgatcggcagc
aaactgattgaaaccatggagcaggcggcggcggacgcccccgcggcccagaaaaccgac
gccgcagtcaccgccgccagcggctggctgcgcaccatccggcaagcgctggatcaagta
aaacgagcaagcgcgtcggcctga

DBGET integrated database retrieval system