KEGG   Achromobacter xylosoxidans A8: AXYL_01561Help
Entry
AXYL_01561        CDS       T01341                                 

Definition
(RefSeq) pyridoxal-phosphate dependent enzyme family protein 4
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXYL_01561
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_01561
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AXYL_01561
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AXYL_01561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1653410..1654507)
Genome map
AA seq 365 aa AA seqDB search
MQMNPSLSGLRCIRCASLWPPADYPEGCPSCLEAGHPAGLECLYEPSTDDAMPLPVLDAV
TLGEGATPCLAMPALAQTEGVGQLWLKCESANPTGSHKDRMAAQLVSRARLADATRVAAA
SSGNAGVSLAAYCAAARLEADIAITTNCPPLQREAMQRFGARLTAFEDSLSRWPHVEDLC
RNHGAFAGTNYLNPPVGTHPYGVEGYKPIALEILEACGVPSDIVVPTARGDLLWGIFLGW
QHLLQSGRIARLPRLHAVEPYARLSRARATGDARKQWDGVTDQYSIAGSTSTLQSLEALS
RSGGTPVEVSDAAAAQAQQRLERMGLATELSSAAALAAVSRLRRSGLLDAESSVVLIVTS
DGRRG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgaaccctagcttgtccggcctgcgctgcatccgttgcgccagcctgtggccg
cccgccgattaccccgaaggctgccccagctgcctggaagccggccaccccgccggcctg
gaatgcctctacgaaccatccacggacgacgccatgcccctgccggtgctggacgccgtc
acgctgggcgaaggcgccacaccctgcctagccatgcccgcgctggcgcagaccgagggc
gtaggccagctctggctgaaatgcgaaagcgccaatcccaccggcagccacaaggaccgc
atggcggcccaactggtgtcgcgcgcgcgcctggcggacgccacccgcgtggcggccgcg
tccagcggcaatgccggggtctcgctggccgcctattgcgccgccgcgcggctggaggcc
gacatcgccatcaccaccaactgcccgcccttgcagcgtgaggccatgcagcgcttcggc
gcccggctgaccgccttcgaggacagcctgagccgctggccccatgtcgaggacctgtgc
cgcaatcacggcgccttcgccggcaccaactatctgaatccgcccgtcggcacccacccc
tacggcgtggaaggctacaagcccatcgcgctggaaatcctggaagcctgcggcgtaccc
agcgacatcgtcgtccctaccgcgcgcggcgacctgctgtggggcatcttcctgggctgg
cagcatctgctgcaaagcggacgcatcgcccgcctgccccggctgcatgcagtggaaccg
tacgcccgcctgtcgcgcgcccgcgcgacaggcgacgcgcgcaagcaatgggacggcgtg
acggaccagtattcgatcgcgggcagcaccagcacgctgcagtcgctggaagctctgtcg
cgatccggcggcacgcccgtggaagtctcagacgcggcggccgcgcaagcgcagcagcgg
ctggaacgcatgggtctggcgaccgagctatcgtcggccgcggcgctggctgccgtgtcg
cggctgcggcgctcgggcctgctggacgcggaatcttcggtcgtgctgatcgtgacctcg
gacggacgccgcggctag

DBGET integrated database retrieval system