KEGG   Achromobacter xylosoxidans A8: AXYL_01630Help
Entry
AXYL_01630        CDS       T01341                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00020  Citrate cycle (TCA cycle)
axy00190  Oxidative phosphorylation
axy00650  Butanoate metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
Module
axy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
axy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
axy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXYL_01630 (sdhD)
   00650 Butanoate metabolism
    AXYL_01630 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AXYL_01630 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ADP14968
UniProt: E3HUK5
Position
1726462..1726845
Genome map
AA seq 127 aa AA seqDB search
MADVKNYGPKRLVVGAHYGVMDFIIQRITAVIMAVYTLVLLIGILMMPAFTYEHWTALFN
FYVGVLPVGQILATLAFIALAWHAWIGVRDIWMDYVKSVGVRLLLQVLTILWLVGSVVYF
AQILWSI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtcaaaaactacggacccaagcgtctggtcgtgggcgcccactacggcgtc
atggatttcatcatccagcgcatcaccgccgtcatcatggccgtgtacacgctggtgctg
ctcatcggcatcctgatgatgccggccttcacgtacgaacactggaccgcactgttcaat
ttctacgtgggcgttcttccggttggccagatcctggccacccttgcattcattgcgctg
gcctggcatgcctggattggtgtgcgcgacatctggatggactacgtcaagtcggtgggc
gtgcgcctgctgctgcaagtgctgacgatcctctggctggtcggttcggtcgtttacttc
gcgcaaatcctctggagcatttaa

DBGET integrated database retrieval system