KEGG   Achromobacter xylosoxidans A8: AXYL_01646Help
Entry
AXYL_01646        CDS       T01341                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:axy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:axy00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:axy00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749657..1750886
Genome map
AA seq 409 aa AA seqDB search
MAITDVVVPQLSESVSEATLLTWKKQPGAAVEADEILIEVETDKVVLEVPAPASGVLAEI
VKGDGSTVTSGEVLARIDTAGKAAVAAAAPAAEAPKAAEQAAAAPAAAPASSAAAGVASP
AASKILAEKGVDAASVAGTGRDGRVTKGDALAAGAPAKAAPAKAAAPVAPPTLSLDGRPE
QRVPMSRLRARIAERLLQSQQENAILTTFNEVNMQAVIDLRSKYKDKFEKEHGIKLGFMS
FFVKAAVAALKKYPLINASIDGKDIIYHGYFDIGIAVGSPRGLVVPILRNADQLSIADIE
KTIADFGRRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKDRAV
VENGQIVIRPMNYLALSYDHRIIDGREAVLGLVAMKDALEDPQRLLLDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgtcgtcgtcccccaactctccgaatccgtctccgaagcgacgctg
ctgacctggaagaagcagcccggcgctgccgttgaagcggacgaaatcctgatcgaagtc
gaaaccgacaaggtcgtgctggaagtgccggctccggcctcgggcgtgctggctgaaatc
gtcaagggcgacggcagcaccgtcacctcgggcgaagtgttggcccgcatcgacaccgcc
ggcaaggccgccgttgccgccgccgcacccgccgccgaagctcccaaggccgctgagcaa
gccgctgccgctccggccgccgcgcccgcttcgtcggcagctgccggcgtggcttcgccc
gccgcctccaagatcctggccgagaagggcgtcgacgccgcttccgtggccggcaccggc
cgcgacggccgcgtgaccaagggcgacgccctggccgccggcgcacccgccaaggccgct
ccggccaaggccgccgccccggtcgctcccccgacgctgtcgctggacggccgtccggaa
cagcgcgtgccgatgagccgcctgcgcgctcgcatcgccgagcgcctgctgcaatcgcaa
caggaaaacgcgatcctgaccacgttcaacgaagtgaacatgcaagcggtcatcgacctg
cgcagcaagtacaaggacaagttcgaaaaagaacacggcatcaagctgggcttcatgtcg
ttcttcgtcaaggctgccgttgccgccctgaagaagtacccgctgatcaacgcctcgatc
gacggcaaggacatcatctaccacggctacttcgacatcggtatcgctgtcggcagcccg
cgtggcctggttgtgccgatcctgcgcaacgctgaccaactgtccatcgccgacatcgaa
aagaccatcgccgactttggccgccgtgcggccgacggcaagctgggcattgaagaaatg
accggcggcaccttctcgatctccaacggcggcgtgttcggctcgatgctgtcgaccccg
atcatcaacccgccgcaatcggccatcctgggcgtgcacgccaccaaggatcgcgccgtc
gtcgaaaacggccagatcgtcatccgcccgatgaactacctggcgctgtcctacgaccac
cgcatcatcgacggccgcgaagccgtgctgggcctggtcgccatgaaggacgccctggaa
gatccgcagcgcctgttgctggacctgtaa

DBGET integrated database retrieval system