KEGG   Achromobacter xylosoxidans A8: AXYL_01739Help
Entry
AXYL_01739        CDS       T01341                                 

Definition
(GenBank) acyl-CoA dehydrogenase, middle domain protein 5
  KO
K20035  
3-(methylthio)propanoyl-CoA dehydrogenase [EC:1.3.8.-]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AXYL_01739
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.-  
     AXYL_01739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1856889..1858715
Genome map
AA seq 608 aa AA seqDB search
MPYVTPLQDFRFALNELAGLGEVLKLPGFEEVTPDLVDAILEENGRFVEQAVAPLNVPGD
TQPPVWKDGQVTTTPGYAQGFRDYAAGGWQGLQHPVAWGGQGLPKLVAAAPGENIQAASL
AFSLCPMLTDGVIEALLTVGSEAQRKQYVPQLIGGKWTGTMNLTEPQAGSDLAQVATRAV
KQADGSYRLSGQKIFITYGDHDLAENIIHLVLARTPDAPAGVKGISLFIVPKFLVQADGS
LGKRNDVWCASLEHKLGIHGSPTAVLLYGSGKGEVGEGAIGYLVGEQNRGLEYMFIMMNA
ARYSVGQQGIGVSERACQHALAYARERVQGRAVEGSAAAVAIVRHPDVQRMLMTMKALTE
AARAVSYVTAAAHDKGTHHPDPEQRSRNRAFYEYMVPIVKGFSTETAVEVASLGLQVHGG
MGYIEETGAAQYYRDARILPIYEGTTAIQANDLVSRKTQRDGGATAHAAIAAMRETLRAV
ETEAKRASAGEQEGLRLLRDNLDSAIQAYEAGVAFILEQSPTNIRAVYSSSVPYLMLAGV
VHGGWQMARAVLACRRHLAAGSTDPFHTAKLATGLFYGAHILPRALALSAAVRAGVVADA
CGASLNIA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgccctacgtaaccccgctgcaggacttccgcttcgccttgaacgagctggccggactc
ggcgaagtcctgaagctccccggcttcgaagaggtcacgccggatctggtggacgccatc
ctggaagaaaacggccgcttcgtcgaacaggccgtggcgccgctgaacgtgccgggcgac
acgcagccaccggtctggaaagacggccaggtcaccaccacgccgggctatgcgcagggt
ttcagggactacgcggcgggcggctggcagggcttgcagcatcccgtggcctggggcggg
caggggctgcccaagctggttgcggcggcgccgggcgagaacatccaggcggccagcctg
gcgttttccttgtgtcccatgctgacggacggcgtgatcgaagccctgctcacggtcgga
tccgaagcgcagcgcaagcagtacgtgccgcaactgatcggcggcaaatggaccggcacg
atgaacctgaccgagccgcaggccggttcggacctggcccaggtcgcgacccgcgcggtg
aagcaggctgacggcagctaccggctgagcggccagaaaatcttcatcacctatggcgac
cacgacctggccgagaacatcatccatctggtgctggcgcgcaccccggacgcgcccgcc
ggggtgaagggcatctcgcttttcatcgtgcccaagttcctggttcaggccgacggcagc
ctgggcaagcgcaacgacgtctggtgcgcgtcgctggagcacaagctgggcatccacggc
agccccaccgccgtgttgctgtacggctcgggcaagggcgaagtgggcgagggcgccatc
ggctatctggtcggcgaacagaaccgcggcctggaatacatgttcatcatgatgaatgcc
gcccgctattcggtggggcagcagggtataggcgtgtcggagcgggcctgccagcacgcg
ctggcctatgcgcgcgagcgcgtacaggggcgggcggtcgaaggctccgccgctgccgtg
gccatcgtgcgccatcccgacgtacagcgcatgctgatgaccatgaaggcgctgaccgag
gcggcgcgcgccgtgtcctatgtgacggcggcagcgcatgacaagggcacgcatcatccc
gatccggagcagcgctcgcgcaaccgggccttctatgaatacatggtgcccatcgtcaag
ggcttttcgaccgagactgcggtcgaggtcgcatccttgggcctgcaggtgcatggcggc
atgggctacatcgaggaaaccggggcggcgcagtactaccgcgacgcacgcatcctgccc
atctacgagggcacgaccgcgatccaggccaacgacctggtcagccgcaagacgcagcgc
gacggcggcgctaccgcccatgccgcgatcgcggcgatgcgggagacgttgcgcgccgtg
gagaccgaggcgaagcgcgcgtccgcgggcgagcaggaggggctgcgcctgctgcgcgac
aacctggacagcgccatccaggcctacgaggccggcgtggccttcatcctggaacaatcg
ccgaccaatatcagggcggtctattccagcagcgtgccttatctgatgctggccggggtg
gtgcacggcggctggcagatggcgcgggccgtgctggcctgccggcgccacctggcggct
gggtccaccgatccgttccatacagccaagctggcgaccggattgttctacggcgcccac
atcctgccgcgggcgctggccctgtcggccgcggtgcgggcgggagtggtggcggacgcc
tgcggcgccagcttgaatattgcataa

DBGET integrated database retrieval system