KEGG   Achromobacter xylosoxidans A8: AXYL_01739Help
Entry
AXYL_01739        CDS       T01341                                 

Definition
acyl-CoA dehydrogenase
Organism
axy  Achromobacter xylosoxidans A8
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1856889..1858715
Genome map
AA seq 608 aa AA seqDB search
MPYVTPLQDFRFALNELAGLGEVLKLPGFEEVTPDLVDAILEENGRFVEQAVAPLNVPGD
TQPPVWKDGQVTTTPGYAQGFRDYAAGGWQGLQHPVAWGGQGLPKLVAAAPGENIQAASL
AFSLCPMLTDGVIEALLTVGSEAQRKQYVPQLIGGKWTGTMNLTEPQAGSDLAQVATRAV
KQADGSYRLSGQKIFITYGDHDLAENIIHLVLARTPDAPAGVKGISLFIVPKFLVQADGS
LGKRNDVWCASLEHKLGIHGSPTAVLLYGSGKGEVGEGAIGYLVGEQNRGLEYMFIMMNA
ARYSVGQQGIGVSERACQHALAYARERVQGRAVEGSAAAVAIVRHPDVQRMLMTMKALTE
AARAVSYVTAAAHDKGTHHPDPEQRSRNRAFYEYMVPIVKGFSTETAVEVASLGLQVHGG
MGYIEETGAAQYYRDARILPIYEGTTAIQANDLVSRKTQRDGGATAHAAIAAMRETLRAV
ETEAKRASAGEQEGLRLLRDNLDSAIQAYEAGVAFILEQSPTNIRAVYSSSVPYLMLAGV
VHGGWQMARAVLACRRHLAAGSTDPFHTAKLATGLFYGAHILPRALALSAAVRAGVVADA
CGASLNIA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgccctacgtaaccccgctgcaggacttccgcttcgccttgaacgagctggccggactc
ggcgaagtcctgaagctccccggcttcgaagaggtcacgccggatctggtggacgccatc
ctggaagaaaacggccgcttcgtcgaacaggccgtggcgccgctgaacgtgccgggcgac
acgcagccaccggtctggaaagacggccaggtcaccaccacgccgggctatgcgcagggt
ttcagggactacgcggcgggcggctggcagggcttgcagcatcccgtggcctggggcggg
caggggctgcccaagctggttgcggcggcgccgggcgagaacatccaggcggccagcctg
gcgttttccttgtgtcccatgctgacggacggcgtgatcgaagccctgctcacggtcgga
tccgaagcgcagcgcaagcagtacgtgccgcaactgatcggcggcaaatggaccggcacg
atgaacctgaccgagccgcaggccggttcggacctggcccaggtcgcgacccgcgcggtg
aagcaggctgacggcagctaccggctgagcggccagaaaatcttcatcacctatggcgac
cacgacctggccgagaacatcatccatctggtgctggcgcgcaccccggacgcgcccgcc
ggggtgaagggcatctcgcttttcatcgtgcccaagttcctggttcaggccgacggcagc
ctgggcaagcgcaacgacgtctggtgcgcgtcgctggagcacaagctgggcatccacggc
agccccaccgccgtgttgctgtacggctcgggcaagggcgaagtgggcgagggcgccatc
ggctatctggtcggcgaacagaaccgcggcctggaatacatgttcatcatgatgaatgcc
gcccgctattcggtggggcagcagggtataggcgtgtcggagcgggcctgccagcacgcg
ctggcctatgcgcgcgagcgcgtacaggggcgggcggtcgaaggctccgccgctgccgtg
gccatcgtgcgccatcccgacgtacagcgcatgctgatgaccatgaaggcgctgaccgag
gcggcgcgcgccgtgtcctatgtgacggcggcagcgcatgacaagggcacgcatcatccc
gatccggagcagcgctcgcgcaaccgggccttctatgaatacatggtgcccatcgtcaag
ggcttttcgaccgagactgcggtcgaggtcgcatccttgggcctgcaggtgcatggcggc
atgggctacatcgaggaaaccggggcggcgcagtactaccgcgacgcacgcatcctgccc
atctacgagggcacgaccgcgatccaggccaacgacctggtcagccgcaagacgcagcgc
gacggcggcgctaccgcccatgccgcgatcgcggcgatgcgggagacgttgcgcgccgtg
gagaccgaggcgaagcgcgcgtccgcgggcgagcaggaggggctgcgcctgctgcgcgac
aacctggacagcgccatccaggcctacgaggccggcgtggccttcatcctggaacaatcg
ccgaccaatatcagggcggtctattccagcagcgtgccttatctgatgctggccggggtg
gtgcacggcggctggcagatggcgcgggccgtgctggcctgccggcgccacctggcggct
gggtccaccgatccgttccatacagccaagctggcgaccggattgttctacggcgcccac
atcctgccgcgggcgctggccctgtcggccgcggtgcgggcgggagtggtggcggacgcc
tgcggcgccagcttgaatattgcataa

DBGET integrated database retrieval system