KEGG   Achromobacter xylosoxidans A8: AXYL_01861Help
Entry
AXYL_01861        CDS       T01341                                 

Gene name
pyrB2
Definition
aspartate carbamoyltransferase 2 (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:axy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:axy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976799..1978091
Genome map
AA seq 430 aa AA seqDB search
MTISQQAFLRDAMRRLNLTRDVFATRIGVKRRALDTWLLPEGSQEFRAMPEVVQRFVSEI
VQNGVLLEKYTQSVQEGPLRDRIAVEGKHQLLSVDQFTRESVEDLFRVADMMQPIARRQK
VSRVLEGAVLGNLFFEASTRTRVSFGSAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVM
SGYVDAMVIRHPDQGSVAEFARATNIPVVNGGDGPGEHPSQALLDLYTILTEFSRLGKLL
DGAHIAMVGDLKYGRTVHSLIKLMALYKNVKFSLVSPKGLEMPSYIIEQASRNGNVIEQK
SSLAEGLAGADVIYATRVQKERFANEENEGYTPDFQISRAIIDAYCGPDTIVMHPLPRDS
RPGANDLSVDLNHDPRLAIFRQTDNGIPIRMAIFAVLLGVEGLVQHSLRDVTWQHPSHIG
PDDSSFHGLE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctcccagcaagccttcctgcgcgacgccatgcggcgcctgaatctcacccgc
gacgtgttcgcgacccgcatcggcgtcaagcgccgcgcgctcgatacctggttgctgcca
gagggctcgcaggaattccgtgcgatgccggaagtggtgcagcgcttcgtcagtgaaatc
gtccagaacggcgtcttgctggaaaaatatacgcaaagcgtacaagaaggtcctttgcgt
gaccgtatcgcggtggagggcaagcatcagttgctgtcggtggatcaattcacccgcgaa
tcggtggaggatctgttccgcgtggccgacatgatgcagcccatcgcccgccgccagaag
gtgtcccgcgtgctggaaggcgcggtgctgggcaacctgttcttcgaggccagcacccgc
acccgcgtcagcttcggctcggcgttctgccgcctgggcggctcggtctgcgacaccacc
ggcttcacgttctcgtccatggccaagggcgaatcgatctacgacaccagccgcgtcatg
agcggttacgtggatgccatggtcatccgccatccggaccagggttcggtcgcggagttc
gcccgcgccaccaacattcccgtggtcaacggcggcgacggcccgggcgagcaccccagc
caggccctgctggacctgtacacgatcctgacggagttctcgcgcctgggcaaactgctg
gacggcgcgcatatcgccatggtcggcgacctgaagtacggccgcaccgtgcactcgctc
atcaagctgatggcgctgtacaagaacgtgaagttctcgctggtgtcgcccaagggcctg
gaaatgccgtcctacatcatcgagcaggccagccgcaacggcaacgtcatcgagcagaag
agctcgctggccgagggcctggccggcgccgacgtgatctacgcgacgcgcgtgcagaaa
gagcgcttcgccaacgaagaaaacgaaggctacaccccggacttccagatcagccgcgcc
atcatcgacgcctactgcggtccggacaccatcgtgatgcacccgctgccgcgcgacagc
cgtcccggcgccaacgacctgagcgtggacctgaaccacgacccgcgcctggcgatcttc
cgccagaccgacaacggcatccccatccgcatggcgatcttcgcggtgttgctgggcgtc
gagggcctggtccagcactccctgcgcgatgtgacctggcagcatccgtcccatatcggg
ccggacgattcgtccttccacggactcgaataa

DBGET integrated database retrieval system