KEGG   Achromobacter xylosoxidans A8: AXYL_01861Help
Entry
AXYL_01861        CDS       T01341                                 

Gene name
pyrB2
Definition
aspartate carbamoyltransferase 2 (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AXYL_01861 (pyrB2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AXYL_01861 (pyrB2)
Enzymes [BR:axy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     AXYL_01861 (pyrB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976799..1978091
Genome map
AA seq 430 aa AA seqDB search
MTISQQAFLRDAMRRLNLTRDVFATRIGVKRRALDTWLLPEGSQEFRAMPEVVQRFVSEI
VQNGVLLEKYTQSVQEGPLRDRIAVEGKHQLLSVDQFTRESVEDLFRVADMMQPIARRQK
VSRVLEGAVLGNLFFEASTRTRVSFGSAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVM
SGYVDAMVIRHPDQGSVAEFARATNIPVVNGGDGPGEHPSQALLDLYTILTEFSRLGKLL
DGAHIAMVGDLKYGRTVHSLIKLMALYKNVKFSLVSPKGLEMPSYIIEQASRNGNVIEQK
SSLAEGLAGADVIYATRVQKERFANEENEGYTPDFQISRAIIDAYCGPDTIVMHPLPRDS
RPGANDLSVDLNHDPRLAIFRQTDNGIPIRMAIFAVLLGVEGLVQHSLRDVTWQHPSHIG
PDDSSFHGLE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctcccagcaagccttcctgcgcgacgccatgcggcgcctgaatctcacccgc
gacgtgttcgcgacccgcatcggcgtcaagcgccgcgcgctcgatacctggttgctgcca
gagggctcgcaggaattccgtgcgatgccggaagtggtgcagcgcttcgtcagtgaaatc
gtccagaacggcgtcttgctggaaaaatatacgcaaagcgtacaagaaggtcctttgcgt
gaccgtatcgcggtggagggcaagcatcagttgctgtcggtggatcaattcacccgcgaa
tcggtggaggatctgttccgcgtggccgacatgatgcagcccatcgcccgccgccagaag
gtgtcccgcgtgctggaaggcgcggtgctgggcaacctgttcttcgaggccagcacccgc
acccgcgtcagcttcggctcggcgttctgccgcctgggcggctcggtctgcgacaccacc
ggcttcacgttctcgtccatggccaagggcgaatcgatctacgacaccagccgcgtcatg
agcggttacgtggatgccatggtcatccgccatccggaccagggttcggtcgcggagttc
gcccgcgccaccaacattcccgtggtcaacggcggcgacggcccgggcgagcaccccagc
caggccctgctggacctgtacacgatcctgacggagttctcgcgcctgggcaaactgctg
gacggcgcgcatatcgccatggtcggcgacctgaagtacggccgcaccgtgcactcgctc
atcaagctgatggcgctgtacaagaacgtgaagttctcgctggtgtcgcccaagggcctg
gaaatgccgtcctacatcatcgagcaggccagccgcaacggcaacgtcatcgagcagaag
agctcgctggccgagggcctggccggcgccgacgtgatctacgcgacgcgcgtgcagaaa
gagcgcttcgccaacgaagaaaacgaaggctacaccccggacttccagatcagccgcgcc
atcatcgacgcctactgcggtccggacaccatcgtgatgcacccgctgccgcgcgacagc
cgtcccggcgccaacgacctgagcgtggacctgaaccacgacccgcgcctggcgatcttc
cgccagaccgacaacggcatccccatccgcatggcgatcttcgcggtgttgctgggcgtc
gagggcctggtccagcactccctgcgcgatgtgacctggcagcatccgtcccatatcggg
ccggacgattcgtccttccacggactcgaataa

DBGET integrated database retrieval system