KEGG   Achromobacter xylosoxidans A8: AXYL_01882Help
Entry
AXYL_01882        CDS       T01341                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00860  Porphyrin and chlorophyll metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
Module
axy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AXYL_01882 (hemD)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AXYL_01882 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADP15215
UniProt: E3HEH0
Position
2002295..2003113
Genome map
AA seq 272 aa AA seqDB search
MVTASAAAELPRVAILTRPDGRNEALAGRLLGAGWTPCILPALEIQALPAMDGGPPRPSD
YDMVVFVSGNAARLYLEQWAQADGPVPWPAEVIAATVGPASAQALRQSACFGANTTVLHP
PENAPSHDSEALWQVLQGLPQRPRRVLLVRGTQGRDWLGDRLEAHGAAVTRHAAYLRRPA
NWGADQLASLRRWAGAGIPATWLITSGEGADALRAGLDAAGLADWWARCRFVLTHPSLER
RVPQACHEGGARPMVKICLPNDESIFQAFVAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtcacggcgtccgcagccgccgagctgccgcgggtcgccatcctgacgcggcccgat
ggccgcaacgaggcgctggccggccgcctgctcggcgccggctggacgccctgcatactt
cctgccctggaaatccaggccttgccggccatggatggcgggccgccgcgcccctccgac
tacgacatggtcgtgttcgtcagcggcaacgcggccaggctatacctggagcagtgggcc
caggcggacgggcccgtcccttggccggccgaggtcatcgccgccaccgtcgggccggcc
agcgcccaggccttgcgccagtccgcctgttttggcgcgaatacaacagttttgcatccc
cccgagaacgctcccagccacgattccgaggcgctttggcaggtcttgcagggcttgccg
caacgcccccgccgcgtgctgctggtgcgcggcacgcagggcagggactggctgggtgac
aggctcgaggcgcacggcgcggcggtgacccgccatgccgcctacctgcgccgcccggcg
aactggggcgccgatcaacttgccagcctgcgacgctgggctggcgcgggcattcctgcg
acctggctgatcaccagcggcgaaggggcggacgcgctgcgggccggcctggatgccgcc
ggcctggcggactggtgggcgcgctgccgcttcgtgctgacgcatccctccctggagcgc
cgcgtgccacaggcctgtcacgaaggcggggcgcggccaatggtaaaaatctgcctgccc
aacgacgagtcgatattccaggcttttgttgctgcttga

DBGET integrated database retrieval system