KEGG   Achromobacter xylosoxidans A8: AXYL_01902Help
Entry
AXYL_01902        CDS       T01341                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXYL_01902 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXYL_01902 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AXYL_01902 (thrC)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AXYL_01902 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2021278..2022687
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGGMAAMEFSDILLEGLAPDGGLAVPEQLPQVSAETLESWRGLPYADLAFEVLS
LFATDIPAEDLRRLTRAAYTQQIFNSEDIVPLRPLDGGLSLLGLSEGPTLAFKDMAMQFL
GQVFEYVLAKRGTTLNIVGATSGDTGSAAEYALRGKQGVAVFMLSPHGRMSAFQRAQMYS
LQDENIHNIAVHGVFDEAQDIVKALAGDLAFKTKYRLGAVNSINWARIAAQVVYYFHGWL
RATSKAGEQVSFAVPSGNFGNILSGHIARRMGLPIRRLVLATNENNVLEEFFRTGVYRPR
PAEQTYATSSPSMDISRASNFERFVFDLVGRDAARVKELWAGMARDGSFDLSDLKPQFEE
RYGFVSGASSHEDRLATIRSVYDETGVLIDPHTADGVKVARDFVEPGVPMLVLETALPAK
FSETIEEALGRPATPPGNLADLESLPQRVEIMDCDQAAVRRFIEANAKV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctctacccgcggcggcatggccgcgatggaattctcggacatcctgctg
gaaggcctggcgccggatggcggcctggcggtgccggagcaactgccccaggtctcggcc
gaaacgctggagtcctggcgcggcctgccgtatgccgacctggcgttcgaagtgctgtcg
ctgttcgccaccgacatcccggccgaagacctgcgccgcctgacgcgcgcggcctacacc
cagcagatcttcaacagcgaggacatcgtcccgctgcgtccgctggacggcggcctgtcg
ctgctgggcctgtccgaggggccgacgctggccttcaaggacatggccatgcagttcctg
ggccaggtcttcgaatacgtgctggccaagcgcggcaccaccctgaacatcgtgggcgca
acctccggcgacaccggttcggcggcggaatacgccttgcgcggcaaacagggtgtggcg
gtgttcatgctgtcgccgcatggccgcatgagcgccttccagcgcgcccagatgtattcg
ctgcaggacgagaacatccacaacatcgccgtgcacggcgtgttcgacgaagcccaggat
atcgtcaaggccctggccggcgatctggcgttcaagaccaagtaccgtttgggcgcggtc
aactccatcaactgggcgcgtatcgccgcccaggtggtgtactactttcacggctggctg
cgcgccaccagcaaggctggcgagcaggtgtcgttcgcggtgccctcgggcaacttcggc
aacatcctgtccggccacattgcgcgccgcatgggcctgcccatccgccgcctggtgctg
gccacgaacgagaacaacgtgctggaagagtttttccgcactggcgtctatcgtccgcgt
cccgccgagcagacctacgccacctccagcccgtcgatggacatttcgcgcgcctcgaac
ttcgagcgcttcgtgttcgacctggtcggccgcgacgcggctcgggtcaaggaactgtgg
gccggcatggcgcgcgacgggtctttcgacctgtccgatctgaagccgcagttcgaggag
cgttatggcttcgtgtcgggcgcgagctcgcacgaagaccgcctggcgacgatccgttcg
gtctacgacgaaaccggcgtgctgatcgatccccacaccgccgacggcgtcaaggtcgcg
cgcgacttcgtcgaacccggcgtgcccatgctggtcctggaaaccgccttgccggcgaag
ttctcggaaaccatcgaagaggcgctgggccgtccggccacgccgccgggcaacctcgcc
gatctcgaatccctgccgcaacgcgtggaaatcatggactgcgaccaggccgccgtgcga
cgcttcatcgaggcgaacgccaaggtgtaa

DBGET integrated database retrieval system