KEGG   Achromobacter xylosoxidans A8: AXYL_02409Help
Entry
AXYL_02409        CDS       T01341                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AXYL_02409
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_02409
   00620 Pyruvate metabolism
    AXYL_02409
   00640 Propanoate metabolism
    AXYL_02409
  Energy metabolism
   00680 Methane metabolism
    AXYL_02409
Enzymes [BR:axy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AXYL_02409
Lipid biosynthesis proteins [BR:axy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AXYL_02409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2551469..2553091
Genome map
AA seq 540 aa AA seqDB search
MLSRADSYTQLASQFQWQVPAAYNIGVDACDKWADGSGRLALIYEKSDGAQSRYTFDQIK
ALSNRLAHSLERHGVKRGDRVAVYLPQAPETAVTHIAVYKMGAVAVPLFTLFGVDAIQYR
LANSGAAALVTDAEGCRKLREIRASLPDLKVVYCIDPDCPDDAVPFHAALAAESDDYTPA
ATAADDPAVIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSHEFFPENAALMWTPADWAWI
GGLLDVLLPSWHHGVPVLARRFEKFDGASAFELMARHGVTHTFLPPTALKMMRGTELPAG
AGALALRSVASGGESLGAELIDWGRRVLGVTINEFYGQTECNMLVSSCSSLFDPCIGAIG
RAAPGHRVAIVDDSGVEVADGQEGNIGVLRPDPVMFLGYWNNPEATAEKFAGDYLLTGDQ
GVRDAEGFIRFVGRNDDVITSAGYRIGPGPIEDCLIGHPAVRMAAVVGVPDAQRTEIVMA
YVVLNEGYEGNDALVKDLQAHVRKRLAAHEYPRAIRFVTSLPTTATGKIIRRELRDGSYS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccagagccgattcctacacgcagcttgcgtcccagttccaatggcaggtgcct
gcggcctacaacatcggcgtcgacgcctgcgacaaatgggccgacggcagcggccgcctg
gcgctgatctacgagaagagcgacggcgcgcaatcgcgctacacgttcgatcagatcaag
gcgctgtccaaccgcctggcgcacagcctggaacgccatggcgtcaagcgcggcgaccgc
gtcgccgtctacctgccgcaggccccggaaaccgcggtgacccatatcgccgtctacaag
atgggcgcggtggcggtgccgctgttcacgctgttcggggtggacgcgatccagtaccgc
ctggccaacagcggcgcggcggcgctggtgaccgacgccgaaggctgccgcaagctgcgc
gagatccgcgccagcctgccggacctgaaggtggtctattgcatcgacccggactgcccg
gacgacgccgtgccgttccacgccgcgctggcggccgaatccgacgattacacgccggcg
gcgaccgcggccgacgacccggccgtcatcatctatacctcgggcaccaccggcaagccc
aagggcgcgctgcatgcgcaccgggtgttgctgggccacctgccgggcgtggagatgtcg
cacgagttcttcccggaaaacgccgcgctgatgtggacgccggccgactgggcctggatc
ggcggcctgctggacgtgttgttgccgtcctggcatcacggcgtgccggtgctggcgcgc
cgcttcgagaaattcgacggcgccagcgccttcgagctgatggcgcgccacggcgtgacc
cacaccttcctgccgccgaccgcgctgaagatgatgcgcggcaccgagcttcccgccggg
gccggcgcgctggcgctgcgctcggtcgccagcggcggcgagtcgctgggagcggaactc
atcgattggggccggcgcgtgctgggcgtgaccatcaacgagttctacggccagaccgaa
tgcaacatgctggtgtcgtcctgctcgtccctgttcgacccctgcatcggcgccattggc
cgcgcggcgccgggccaccgcgttgctattgtggatgacagtggcgtcgaagtggcggat
ggacaggagggcaatatcggcgtattgcgcccagacccagtgatgttcctggggtactgg
aacaaccccgaggccaccgccgaaaagttcgcgggcgactatctgctgaccggcgaccag
ggcgtgcgcgacgccgagggcttcatccgcttcgtcggccgcaacgacgacgtcatcacc
agcgccggctaccgcatcggccctggcccgatcgaggactgcctgatcggccaccccgcg
gtgcgcatggcggcggtggttggcgtgcctgacgcccagcgcaccgagatcgtgatggcc
tatgtggtgctgaacgaaggctacgagggtaacgacgcgttggtgaaggatcttcaagcc
catgtgcgcaagcgcctggcggcccatgagtatccgcgcgcgatccgatttgtaaccagt
ttgccaaccactgccaccggcaagatcatccgccgcgagttgcgcgacggcagctactcc
tga

DBGET integrated database retrieval system