KEGG   Achromobacter xylosoxidans A8: AXYL_02499Help
Entry
AXYL_02499        CDS       T01341                                 

Definition
class II aldolase and adducin N-terminal domain-containing protein 2
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:axy00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2647916..2648701
Genome map
AA seq 261 aa AA seqDB search
MSTALREKSYFDTRATQEMARHLHAVPRSIQETMAYACRILAMTEQEAGLAGQISVRSQR
PGAYWTLRFGLGFDEATPADFIEVDRDLHTLTGEGMANPATRFHLWVYEARPDVQSIIHT
HSPWASALAAARQPLVISQMDMTPLHDDCAFLGEWPGVPIADQEGVIISGALGKKRAIIL
AHHGYLTAGVSCEEATYLSVYLERAARMQIRAQAFGPLTPVDDALAREAHDYLLKPSIVN
ATFNYWARQTHGIAPLPLPAA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcattacgagagaaatcctatttcgacacccgcgccacgcaggaaatggcg
cgccacctgcacgccgtgccgcgcagcatccaggaaaccatggcctatgcctgtcgcatc
ctggccatgaccgagcaggaagcggggctggcgggccagatcagcgtgcgttcgcagcgg
ccgggggcctactggaccctgcgcttcgggctgggcttcgacgaagccacgccggccgac
ttcatcgaggtggaccgcgacctgcacacgctgacgggcgagggcatggccaatccggcc
acccgctttcacctgtgggtgtacgaggcgcggcccgacgtgcagtccatcatccacacg
cattcgccctgggcctcggcgctggccgcggcgcgccagccgctggtgatctcgcagatg
gacatgacgccgctgcacgacgactgcgcgttcctgggcgaatggccaggcgtgccgatc
gccgaccaggaaggcgtgatcatttccggcgcgctgggtaaaaagcgcgccatcatcctg
gcgcatcacggctacctgacggccggcgtttcatgcgaagaggcgacctatctgtcggtc
tacctggagcgcgcggcgcgcatgcagatccgcgcgcaggcgttcggcccgctgacgccg
gtggacgacgcgctggcgcgcgaagcgcacgactatctgctcaagccctcgatcgtcaac
gcgacgttcaactactgggcccgccagacgcacggcatcgcgcctttgccgctgcctgcc
gcctga

DBGET integrated database retrieval system