KEGG   Achromobacter xylosoxidans A8: AXYL_02722Help
Entry
AXYL_02722        CDS       T01341                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00010  Glycolysis / Gluconeogenesis
axy00020  Citrate cycle (TCA cycle)
axy00620  Pyruvate metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
axy01130  Biosynthesis of antibiotics
axy01200  Carbon metabolism
Module
axy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXYL_02722 (aceF)
   00020 Citrate cycle (TCA cycle)
    AXYL_02722 (aceF)
   00620 Pyruvate metabolism
    AXYL_02722 (aceF)
Enzymes [BR:axy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXYL_02722 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 CAT HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADP16042
UniProt: E3HS96
Position
2916644..2918296
Genome map
AA seq 550 aa AA seqDB search
MSNIVQIKVPDIGDFKEVEVIEVLVAVGDTIKAEQSLITVESDKASMEIPASQGGVVKSI
SVKVGDKVAEGTVVLEVEAAGEAAAPAAAPAKAEAPKAEAKAAPQPATAAPAAPAAASGP
VNIEVPDIGDFKEVEVIEIMVAVGDTIKAEQSLITVESDKASMEIPASQGGVVKEVKVKV
GDKVAKGSVVVVVEGAAPAAASAAPAPAAKAEAAAAPAAKAEVAPAPAAQRPAPAAALED
ADLKPGQLPHASPSVRKFARELGVNLSKVKGSGPKDRITADDVRGFVKQALAAGPTAAAG
GSADGAALGLLPWPKVDFTKFGPIEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITD
LEALRVTLNKENEKSGIKVTMLAFLIKAVVAALKKFPEFNASLDGDNLVLKQYYHIGFAA
DTPNGLVVPVIRDADKKGILQIAQEMTDLSKKARDGKISPADMQGGCFSISSLGGIGGTS
FTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLIVPLSLSYDHRVIDGASAARFNAYLGA
LLADFRRIAL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatcgtgcaaatcaaggttcccgacattggcgacttcaaggaagtggaagtc
atcgaagtgctggtggcggtgggcgacacgatcaaggccgaacaaagcctgattaccgtc
gaatccgacaaggcctcgatggaaatccccgcgtcgcaaggcggcgtggtgaagtcgatc
agcgtgaaggtgggcgacaaggttgccgaaggcacggtcgtgctggaagtggaagcggcg
ggcgaggctgcagcccccgcagctgcgccggccaaggcagaggctcccaaggccgaagcc
aaggctgccccgcagccggccaccgccgcgccggctgcgccggctgccgccagcggtccg
gtcaacatcgaagtgccggacatcggcgacttcaaggaagtcgaagtcatcgaaatcatg
gtcgcggtgggcgatacgatcaaggccgagcaaagcctgatcaccgtcgagtccgacaag
gcctcgatggaaatccccgcctcgcaaggcggcgtggtcaaggaagtgaaggtcaaggtt
ggcgacaaggtcgccaagggctcggtcgtggtcgtggtggagggcgccgcgcccgccgcc
gcttcagccgcgccggctccggccgccaaggctgaagccgccgctgcacccgcggccaag
gccgaggttgcgccggcgcctgccgcgcagcgtccggcgcccgccgccgcgctcgaagac
gccgatctcaagccgggccaactgccgcacgcttcaccctcggtgcgcaagttcgcgcgc
gaactgggcgtgaacctgagcaaggtcaagggctccggtcccaaggaccgcatcaccgcc
gacgacgtgcgcggtttcgtcaagcaggcgctggctgccggcccgacggccgccgcgggc
ggttcggccgatggcgccgcgctgggcctgctgccgtggccgaaggtcgacttcaccaag
ttcggcccgatcgaagccaagccgctgtcgcgcatcaagaagatttccggcgcgaacctg
caccgcaactgggtcatgatcccgcacgtcaccaacaacgacgaagcggacatcaccgac
ctggaagcgctgcgcgtcacgctgaacaaggaaaacgagaagtcgggcatcaaggtcacg
atgctggccttcctgatcaaggccgtggtcgcggccctgaagaagttccccgagttcaac
gcctcgctggacggcgacaacctggtgctcaagcagtactaccacatcggttttgccgcc
gacacgcccaacgggctggtagtgcccgtgatccgcgatgccgacaagaagggcattctg
cagatcgcccaggaaatgaccgacctgtccaagaaggcgcgcgacggcaagatctcgccc
gccgacatgcagggcggctgcttctcgatctcgtccctgggcggcatcggcggcacctcg
ttcacgcccatcatcaacgctcctgaagtggccatcctgggcgtgtcgcgttccgcgcac
aagcccgtgtgggacggcaagcagttcgtgccgcgcctgatcgtgccgctgtcgctgtcg
tacgaccaccgcgtcatcgacggcgcctccgccgcgcgcttcaacgcctatctgggcgcc
ttgctggccgacttccgccgcatcgcgctgtaa

DBGET integrated database retrieval system