KEGG   Achromobacter xylosoxidans A8: AXYL_02740Help
Entry
AXYL_02740        CDS       T01341                                 

Gene name
cheB1
Definition
chemotaxis-specific methylesterase 1 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:axy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AXYL_02740 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AXYL_02740 (cheB1)
Enzymes [BR:axy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AXYL_02740 (cheB1)
Two-component system [BR:axy02022]
 CheA family
  CheA-CheYBV
   AXYL_02740 (cheB1)
Bacterial motility proteins [BR:axy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AXYL_02740 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2934661..2935719
Genome map
AA seq 352 aa AA seqDB search
MKKISVLCVDDSALVRGLMTEIINSQPDMEVVATAPDPLVARELIKRHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLLEYT
EIIADKIRAASRAKLRAPAAHAAPAAPAPMLRRPLSSSEKLVIVGASTGGTEAIREVLQP
LPPDSPAILITQHMPAGFTRSFAQRLDALCAVTVREAVHGDRVLPGHVYLAPGGDMHMRL
GRSGANYVIELEASEPVNRHRPSVDVLFNSAAVAAGKNAIGVILTGMGKDGAAGMLAMHR
AGAHTIAQDEASCVVFGMPREAIALGAADEVVSLSAISERILTRLGDRGHRV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattagcgttttgtgcgtggacgattcggcgctggtgcgcgggctgatgacc
gagatcatcaacagccagccggacatggaagtggtcgcgaccgcgcccgatcctctggtg
gcgcgtgaactcatcaagcgccacaacccggacgtgctgacgctggacgtggaaatgccc
cgcatggacgggctggatttcctcgaaaagctcatgcgcctgcggcccatgccggtcgtg
atggtgtcgtcgctgaccgagcgcggcggtgaaatcacgctgcgggccctggaactcggc
gccatcgacttcgttaccaagcccaagctgggcatacgcgacggcctgctcgagtacacc
gagatcatcgccgacaagatacgcgcggcctcgcgcgccaagttgagggcgcccgcagcg
catgccgcacccgccgcgccggcgcccatgctgcgtcggccgctgtccagctcggaaaag
ctggtcatcgtcggcgcctccacgggcggcaccgaggcgatccgcgaggtcctgcagccg
ctgccgccggacagcccggcaatcctgatcacccagcatatgccggcgggcttcacgcgc
tccttcgcgcagcgcctggatgccctgtgcgcggtgaccgtgcgcgaagccgtgcacggc
gaccgggtgctgccagggcacgtatatctggcgccgggcggcgacatgcacatgcgcctg
gggcgcagtggcgccaactacgtgatcgaactcgaagccagcgaacccgtcaatcgccat
cgcccgtcggtggacgtattgttcaattcggccgcggtcgccgctggcaagaacgccatc
ggcgtcatcttgaccggcatgggcaaggacggcgccgccggcatgctggccatgcaccgc
gcgggcgcgcacacaattgcgcaggacgaagccagctgcgtcgtcttcggcatgccgcgc
gaggcgatcgccttgggcgctgcggatgaagtggtttcgttgtcggcgataagcgaacgc
attctgactcgcctgggcgaccgtgggcaccgcgtctga

DBGET integrated database retrieval system